Identifiers and Description

Gene Model Identifier

Contig13019.0.1.g85

Standard Name

NSUN2a

Aliases

Contig13019_0_1_g85

Description

NOL1/NOP2/sun family

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
SGDYBL024W2.000724368835138e-100NCL1 SGDID:S000000120, Chr II
from 172534-174588, Genom...
T. thermophilaTTHERM_006845404.9989222866409065e-79NOL1/NOP2/sun family protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig13019.0.1.g85(coding)
ATGGGTACTGACTACGACCCACCCACTCGCACTTAGGGAGTGGACGAATATCAAATGTCA
GATGCTACTCTAAGACTCCTCGAGAGAGAATTAGGTTAAACTAACTCCCTTAGACAGCAA
AACGCTCAACAGAGTTAAATGTTGAACAGTTTCCAAGCACAAACCGAAGATAGCAAAGTT
TAACCAGAAGAACTAAAGCAAAGTGAGATTAAGCAGACATATCAGTAGAAAAATGGAAGA
ACAAGAGCTTTTCACACCAATAACAAAAATGAGAATCATGAATCAGAGAAAAAGGAGAAA
GAACCAATATCCAAGACTAAAGAAAAGAGACATAAGTGGCATGAAGCCAAGAAGGAGAAG
AAAGAGCAGAGAGAAGACGATTGGGCTAATGGCACTCACAAGAAGAAAACTGATTATGAG
CTATTGGAAATGAAAAACAACGAGGACTTTAAGCAATACTACAAGAACTTGAGAATATTG
CCAGAGGAGGAATTCGAAACTTTCTACAAAACTTTACAAGAGCCACTAGACATTTGCTTC
AGAGTAAACTCAGTAGATAAGCATTTTGCAAAGACTCAGCAAGAAATCAATGACCTCATT
TTGAAAATTAAATAAATTGAGGATATTAAAGATAAAGTGCCAAAGAGACTTGAGTGGTAC
CCAAATGACCTCGCTTATACTTTTAATGAATGCAGTAGAGCTGAGATGAGAGCTAACCCA
CTTTTAAAGAACTTCCATTAATTCTTGATATTGGAAACTGAAATGGGTAGAATATTTAGA
TAGGAAGCTGTTTCTATGATTCCAGTAACACTCCTAAAAATTGAGCCTCATCACTCCGTG
ATCGATATGTGTGCTGCACCAGGTTCCAAGACCATTCAAATTTTGGAGTATTTACATTAA
GGTATGAATAAAGTACCAAATGGCTTTGTCATTGCTAATGACACAGATCAGAAAAGAGCA
TACTTATTGACTCATTAGGCTCGTAGACTAAACTCATCGGCTTTGTTGATTACAAATAAT
GATGCAAGATTTATGCCAAACATGAGATTTGAAGATGCACAGAAACATCATCATAATTTA
AAGTACGATAGAATACTCTGTGATGTTCCTTGCTCTGGAGACGGAACTTTACGTAAAAAC
CTAGCACTCTGGAGAAACTTTAACTCACATTTGGGCCACGCATGTCACCCACTTCAATTA
GATATTCTTGAGAGAGCCTTCAAAATGCTGAAGAAGGGAGGTAGATTAGTATATTCTACT
TGCTCTTTCAATCCAATTGAGAATGAAGCAGTTGTTGCTGCTGCTCTCTCTAGACATATC
AAATAGATGGAGTTAGTCGATGTCTCGTCTGAAGTTAGCCCACATTTGAAATATAGACCA
GGTCTTGTAAACTGGAGAGTGTATCATAGAGCCAAGGGTAAGAGAATACCAGAGGCATGG
TATGAATCATATGATAAAGTCTAAAATATCCAAAGAAAGATCGTCAAAGAAACTATGTTC
ACAGATACTTACACAATGTTCAATAACGAGCCAGATAGAACAGATGACATGAAAAATGAT
CCCTTAAACTTGCGCAGATGCATGAGATTTTTCCCACATGACGACAATTAAGGAGGTTTC
TTTGTCGCAGTCTTTACTAAGATTCATGACCAGGAAGAAGGGATTGTGTACGATGATATG
TACTCTATGAATGCATGGAGTGATCCAAAAGTGAAGCAAAAGCCCATTTTAGAGGATTTG
AGAGATTTTGCTGAAGACTATGAAAAAGAACTCAAAGCCTACGAAGAGAAGCATAACGTT
CCAGCAGATTAATCTCAGCAAAATTAAATTCTATAGATGGTGAAAGAAGCTCAAGCTTAG
TAAAAGCAATAACTCAAGGAATCTGGAGTTCAACTTGGAAAAATGAGTTAGTAAGTAGAT
GAGGAAAAGGAGCATCTGTTCCCATTTGAGAAATTAATTGATAACAAATAAGAATTATGG
ATGAATTTGCAGATGTTCTATGGTATCAGTAGTGAGTTCCCAAGTGAAAATTTGTACTTC
CAAAAGGACACTACCAATTTCATTGTGTTTGGTAGCAATGGCATTAATACTTTGATGAGG
TGCCAAAGAAAATACAAATTTAAGGTAGTGAATATGGGAGTCAAACTTTTCTGTAAAAAC
AGGGATAATAAGTCACCTGCTTAAGTAAGTTTAATTAAAAGCTATCAACCCCAACAAAAC
TTGAACAATCTTTTTTTTAGTTATCAACCATCACCTTTAATCTATTTTCTATAGTATCGT
CTCTTGTAAGAAGGTCTGGAAATTCTTATGCCTTACATGTCAGATGATAGAAAGATCCCA
GTTTCAAAGTTGCTCTTCGCTCAATTTTTAGATAAATTTAACTTCACTTAGGATGAGCTG
GCTAAGATGGGACATGCAGAGCAATTTGCAGGTCGTGACCAAGGAAGTGCTGTAATGGTT
TGTGGAGGAGATTTGTACGTCACTATCTGGATTGGAGTGAACAATGTTAGTTTGATGATT
GGCAAAGAAGAAATTAAGAGTTTCAAGTTCTTGCTCATTAATCAGCTCGAATGA


>Contig13019.0.1.g85(protein)
MGTDYDPPTRTQGVDEYQMSDATLRLLERELGQTNSLRQQNAQQSQMLNSFQAQTEDSKV
QPEELKQSEIKQTYQQKNGRTRAFHTNNKNENHESEKKEKEPISKTKEKRHKWHEAKKEK
KEQREDDWANGTHKKKTDYELLEMKNNEDFKQYYKNLRILPEEEFETFYKTLQEPLDICF
RVNSVDKHFAKTQQEINDLILKIKQIEDIKDKVPKRLEWYPNDLAYTFNECSRAEMRANP
LLKNFHQFLILETEMGRIFRQEAVSMIPVTLLKIEPHHSVIDMCAAPGSKTIQILEYLHQ
GMNKVPNGFVIANDTDQKRAYLLTHQARRLNSSALLITNNDARFMPNMRFEDAQKHHHNL
KYDRILCDVPCSGDGTLRKNLALWRNFNSHLGHACHPLQLDILERAFKMLKKGGRLVYST
CSFNPIENEAVVAAALSRHIKQMELVDVSSEVSPHLKYRPGLVNWRVYHRAKGKRIPEAW
YESYDKVQNIQRKIVKETMFTDTYTMFNNEPDRTDDMKNDPLNLRRCMRFFPHDDNQGGF
FVAVFTKIHDQEEGIVYDDMYSMNAWSDPKVKQKPILEDLRDFAEDYEKELKAYEEKHNV
PADQSQQNQILQMVKEAQAQQKQQLKESGVQLGKMSQQVDEEKEHLFPFEKLIDNKQELW
MNLQMFYGISSEFPSENLYFQKDTTNFIVFGSNGINTLMRCQRKYKFKVVNMGVKLFCKN
RDNKSPAQVSLIKSYQPQQNLNNLFFSYQPSPLIYFLQYRLLQEGLEILMPYMSDDRKIP
VSKLLFAQFLDKFNFTQDELAKMGHAEQFAGRDQGSAVMVCGGDLYVTIWIGVNNVSLMI
GKEEIKSFKFLLINQLE