Identifiers and Description

Gene Model Identifier

Contig356.0.g103

Standard Name

NRP1

Aliases

Contig356_0_g103

Description

hypothetical protein

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

No Data fetched for Domains

Gene Expression Profile

No expression data available at this time.

Homologs

No Data fetched for Homologs

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig356.0.g103(coding)
ATGACAAGAGGAGGCAACTTGGTTTTACATGGGATCACCAACACAGTCGTAAAAGTTGAT
AACAACGGAACAGTTGTTTCAGTTACAAATCAAACTGGTACTATAAACACAACAGCAAAC
AACACAGGGTGGCTAAGCAATGCCACTAATGGTACAAACACAGGAGGAGGAACAAATACC
ACTACTAATAACAACACTAGCAACAACACCAGTAATAACTCCACTAATAACAATAATACA
ACTAATAACAACTCCAGCAATAGCACTAATAACACTGGTACATCTAACAATACCAATAGT
GGTAATACAACCACAAATTAAACAAGCAATAATAGTGGAGGCTCAAATACAACCACAAAT
AATAATACTTAGTAGACTAATGGAACGACAAATAGTACAACTAATAACACGTAGACAACC
AATAATACCAGCAATAGTACTACTAATAATACTTAAAACTCTAATAGCACCTCCAATAAC
ACTGGTCAGGCTAATTAGACAACCAATGGCACTTAGAATGCAACTTAAAACCAAACTAAT
AGCACCAACACAACCACTCCAACAAATAACACTACTAACTCCACTTAGAATAGTACTAAT
ACCACGCAAGGAACAAATAGTACAACAAACAATACAAGTAATAGTACAACAAACACCACA
ACCAATAGTACCTCGAATAATACCACCAATTCAACCTCTAATAGTACCACTAATAGTACT
AACAATAGTACAACTAATAGTACTACCAATAGCACAACCAATAACACCACCAATAGCAGC
ACCACCAATAGCACGAATAATACAAGTGGTAATTCTACCAATAGTACAAGCAACAGTACA
GGTAATAGTACAAGTAATAATACCACAAGCAACAACACCACTAATAGTACAAGCAATAAT
ACGAGCGATACAAACTAAACTAATTCCACCACAAATAACACCCTGAGTAATACAACAAAT
ACGACGAATCCCTCAAATACTACGAATAGCACAAATGCAACAAATTCATCTAATTCCACA
AATACAACGAACACAACTGATTAAACGAATAGTACAAATACGACAACTAATGCTACAAAT
ACTACCAATCCATCTAATACAACCAACACTACTAACAGCACGAATGGAACAAATACTACC
AACACTAATAATACTACAGATAGTACTAATAGCACGACAAATAGCACGACGAATGGCACT
AATACAACGAATACTACCAACACTACCAATGGAACTAATACTACTAATGGGACAAGCACG
ACAAATACAACAAATTAAACAAATAACAGCAACTCAACTAATACCACAAGCAACACAACA
ACGCCTACCAACAACACCCAAAACAACTAAACAAATGCAACCAGCAATAACACAAGTGCA
GACAATTCTACGAGCAACAGTACCAATAATTAAACAAGTAACAACACTCAAACAAACAGC
ACCAGCAGTAATTAAACAAACAGTACTCAATCAAACCAGACTAATAGCACGACAGGAGAT
AATAGTACTTAAAGTAGTAATACGACTAATCAGACACAGCCAACGAATACCACAAATACC
ACTCAAACTAACAGCACAAGCAACACAACCAACCCACTAAACAACAACACATTAAACAGC
AATTTGACAAATGATACCACCCCAGATAATAGCACATAGAACTCCACCACGAACACTTCA
GCTCTTAATGATACAACTGCAACCCCTACTTTTGCTCGATCTCAAACTGATTTAACTGGA
GCGGGGTAAGACTCAGTACCAGAGACTGAAACATCTGACACCGTGTTAGTAGCTCAAATT
GCTCTACCAGTTGTGGGCTCCGTTATGATAGGTGGCCTAGTTACACTGGCGCTTTTAATG
AAAAAAGCTAGTTTCGGTACTCTGGTTTAGACTAAACCAAAAACTGTTAGCATTTAACAA
TTGGACACCACGCTAAGGAATTTGAAACTGAATCAATTTACTACAAATCACACACATCAA
ACTTCAGTAACTCAAGGTGACTTGGAGTATGGACACAGCAGCAACACTAGCATATCTCAA
AAAAGTCCATTTATGGAACAAAAAAGTATTCTTAGGAGCAGAAATAGCGTAATGCCATTC
TAGAGCAGTAACACTGTGGGTAATATGAACAGAAATGTTGACATATCTATGATCAGTAAC
TCACATTTACTATATTGA


>Contig356.0.g103(protein)
MTRGGNLVLHGITNTVVKVDNNGTVVSVTNQTGTINTTANNTGWLSNATNGTNTGGGTNT
TTNNNTSNNTSNNSTNNNNTTNNNSSNSTNNTGTSNNTNSGNTTTNQTSNNSGGSNTTTN
NNTQQTNGTTNSTTNNTQTTNNTSNSTTNNTQNSNSTSNNTGQANQTTNGTQNATQNQTN
STNTTTPTNNTTNSTQNSTNTTQGTNSTTNNTSNSTTNTTTNSTSNNTTNSTSNSTTNST
NNSTTNSTTNSTTNNTTNSSTTNSTNNTSGNSTNSTSNSTGNSTSNNTTSNNTTNSTSNN
TSDTNQTNSTTNNTLSNTTNTTNPSNTTNSTNATNSSNSTNTTNTTDQTNSTNTTTNATN
TTNPSNTTNTTNSTNGTNTTNTNNTTDSTNSTTNSTTNGTNTTNTTNTTNGTNTTNGTST
TNTTNQTNNSNSTNTTSNTTTPTNNTQNNQTNATSNNTSADNSTSNSTNNQTSNNTQTNS
TSSNQTNSTQSNQTNSTTGDNSTQSSNTTNQTQPTNTTNTTQTNSTSNTTNPLNNNTLNS
NLTNDTTPDNSTQNSTTNTSALNDTTATPTFARSQTDLTGAGQDSVPETETSDTVLVAQI
ALPVVGSVMIGGLVTLALLMKKASFGTLVQTKPKTVSIQQLDTTLRNLKLNQFTTNHTHQ
TSVTQGDLEYGHSSNTSISQKSPFMEQKSILRSRNSVMPFQSSNTVGNMNRNVDISMISN
SHLLY