Identifiers and Description

Gene Model Identifier

Contig15415.0.0.g26

Standard Name

NPRL3

Aliases

Contig15415_0_0_g26

Description

Nitrogen Permease regulator of amino acid transport activity 3

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Domains

  • ( pfam03666 ) Nitrogen Permease regulator of amino acid transport activity 3
  • ( pfam13893 ) RNA recognition motif (a k a RRM, RBD, or RNP domain)
  • ( pfam00076 ) RNA recognition motif (a k a RRM, RBD, or RNP domain)
  • ( pfam14259 ) RNA recognition motif (a k a RRM, RBD, or RNP domain)

Gene Expression Profile

No expression data available at this time.

Homologs

No Data fetched for Homologs

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig15415.0.0.g26(coding)
ATGGAATACGACAGAGATCAAAAGCTACTACTGAACATTGTGAAGAAATTTCCAAGTGCT
TTTAGTGAGCAAGATTTACTGGGAGAGAAGGAGTTGTTTTATTAGCAATCTCAAGATGAT
ATGAACGACACCTAGGAATCAGGTCACAAATCAGTGTTTGGCTTCACCAAAGCATTCTTT
ACCGAACTGTTTTTACCAAAGGAAACTTAATTTTAGAACACTCTATTTGATTTAGTAAAG
ATGAACATGGATTCGAATAATGATATCGTAAGTGTCAATCAAAGTAGTTCTACAAGCAAA
GATAATAAGTAATAGCAACCTAATTTTAAAGCGTTTGCTTTCGCCAAAGAGTAAATCAGA
GATGGATTCATAGGCAAATAAAGCTACAAAATATTCAGACTAAGACAGTAAATGAAAGAA
AACAGTAAAAATCTTTTAGAAAATGAGAAAGATCACTTGAGAAGAAAAATCATCAAAGAA
TCAATTCTTGCTTAACATCTAAGAGATATCTTTGAAAGTTTCTATCTTAAAAAGACAACA
ACTATACATGTGAATAATTGGATGAAATTTTCACTAAATTAATCTCCAAGCTACAATCAA
ATTCAATCTTAAATTAACGAAAGGTCTTAAAAAAATGGTTTAGCATTCAGTGAAATAGTG
AAAGTAGTTCAACATTTGATATTTTGGAATTAAGCTAAGATCATCTATCCAATAAATCTC
AAACAAATTTATGTGCTTAATAGTGAGATATCGATTGCTAACCAAGAAACTGCTTAGAAG
TTCTATACTAAATTCAATCACCTTAAAATCACATTTGCATAAGTTCTAAATATGTTTTCA
TTACCACATAAATTGCAGACTCTCTACTAAACCCTCAGCATGACACTTAGAGACTTTATA
AACATTCTGATATTTTTACTGCAGCACAAAGTAATAGAGGAAAGAAATATTTATATCGTG
ATGAAATTACCTTCTAAGCATTAAAACTTAAAAGAATTGTAAAAGTAATTCTTTGAAACT
GCTTATGAAAATCTACTGGTTAATAATAAAAGATCTAATTCTTAAAGTGTTAATAAAGGA
AGGAGAGGTTCACTTTAAGATATAAGTCCGCAAAGGAATTTAGCATAGTAAAGCTTTTAA
AATTAAGACAACGCTAATTCAAACAATAACTAACATAAATTGACTAAGAAATAAAGTCAA
ATTACAATTGAAGATTACATAGAATTGATAAGAGACAATAACTCCTATGAATTTAAATTA
TTAGAGAAAATTTACCCATTCTTAAATGGAGAATTTAATCACTATGACATCATGATGATA
ACGCTATTTTTCAATTATAACATTTCATTTTAAAATCTTGAATCAAACATCAATATGGAC
GAAAAGAACATGAGTCTTGAAGACCTCATTAAGAGAGACAGAGGTAACAAGAGAGGCCGT
GGAGCTATGAGAGGTGGCAGAGGTGGAAATCGTGGAGGTCTCGCTCGCGGTGGTGCCTAA
GGTCTCAGAAGACAAAGTGGCGGCAACGATAGATTCAGAAGAGGTGGAATGAACAGAGGT
GGCGACAGAAGACTCGAAAGAGGAGGAAATCGTAATCTACAGAGAGGTAATAGAGGAGGA
CGTAATGATGTCTAAAGGGATAGACCTTTCATTAGAAAGCCAATTAGATAACCAATTTAA
GCCTCAAGAATTCCAAGAGGTGTAATTGAGGGTGGTCGTAGAATCAGAAGACCTCTCGGC
GTTGCTAGAGGACTTGGCCAAAGAAAGATGATCCCTAACATTGGAAGAGCTGGAGAAGGA
CCCCTCAAGATTACCAAAAAGATTGATTTGACTCCTAAGGCTCTAAGAAAACTAAAAGTC
AGAAACATCGATGAGAAACAAGTTACAAACGAGGATCTAAAGGTATAATCATCAATAATT
AAACTAATCCTTCTATAGAGACTATTCGAGAAGCTCGGTACACTTAAAGAATGCAAGTTC
GATCGCAATAACTTTGGGCAATTCCTTGGTTCAGCTACTGTTGTGTATGACAAACCAGAA
GATGCCTAGGAAGCAATCCAGCAATATCATGGAGCTCAACTAGACGATAGAATTCTTACT
GTTGAGTTCGATAGACCAGTGATTGTACCCAAAGTTAGAGCTAACAACGCAATTGGAAAG
GGAAAGACCCTCAGAGTGGGAGGCAGGAGATGA


>Contig15415.0.0.g26(protein)
MEYDRDQKLLLNIVKKFPSAFSEQDLLGEKELFYQQSQDDMNDTQESGHKSVFGFTKAFF
TELFLPKETQFQNTLFDLVKMNMDSNNDIVSVNQSSSTSKDNKQQQPNFKAFAFAKEQIR
DGFIGKQSYKIFRLRQQMKENSKNLLENEKDHLRRKIIKESILAQHLRDIFESFYLKKTT
TIHVNNWMKFSLNQSPSYNQIQSQINERSQKNGLAFSEIVKVVQHLIFWNQAKIIYPINL
KQIYVLNSEISIANQETAQKFYTKFNHLKITFAQVLNMFSLPHKLQTLYQTLSMTLRDFI
NILIFLLQHKVIEERNIYIVMKLPSKHQNLKELQKQFFETAYENLLVNNKRSNSQSVNKG
RRGSLQDISPQRNLAQQSFQNQDNANSNNNQHKLTKKQSQITIEDYIELIRDNNSYEFKL
LEKIYPFLNGEFNHYDIMMITLFFNYNISFQNLESNINMDEKNMSLEDLIKRDRGNKRGR
GAMRGGRGGNRGGLARGGAQGLRRQSGGNDRFRRGGMNRGGDRRLERGGNRNLQRGNRGG
RNDVQRDRPFIRKPIRQPIQASRIPRGVIEGGRRIRRPLGVARGLGQRKMIPNIGRAGEG
PLKITKKIDLTPKALRKLKVRNIDEKQVTNEDLKVQSSIIKLILLQRLFEKLGTLKECKF
DRNNFGQFLGSATVVYDKPEDAQEAIQQYHGAQLDDRILTVEFDRPVIVPKVRANNAIGK
GKTLRVGGRR