Identifiers and Description

Gene Model Identifier

Contig4371.0.g71

Standard Name

NPL3

Aliases

Contig4371_0_g71

Description

RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Domains

  • ( pfam00076 ) RNA recognition motif (a k a RRM, RBD, or RNP domain)
  • ( pfam14259 ) RNA recognition motif (a k a RRM, RBD, or RNP domain)
  • ( pfam13893 ) RNA recognition motif (a k a RRM, RBD, or RNP domain)
  • ( pfam00098 ) Zinc knuckle
  • ( pfam14392 ) Zinc knuckle
  • ( pfam04652 ) Vta1 like

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_002192501.999790113608142e-24hypothetical protein
SGDYPL190C0.000009999254677478949NAB3 SGDID:S000006111, Chr XVI
from 187725-185317, Geno...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig4371.0.g71(coding)
ATGTCAAGAAATCCACAAATATACGTTGGAGGTGTCAGTCGCAGAACTCACCCTGAGGAC
TTGGAGAAGGCTTTTGAGAAATACGGAAAGATTAGAAGTTTCTCATTCAAGGCTAAATAC
GCATTCATTGAATACGACGATTATCATGATGCAAGAGACGCCATTGAGAGAATGGACGGC
AAATCATTCGATGGTGAGAGACTTATCGTCGAACACACAAAGGAGGGAAGAGGACGCAGA
GGTCCATCTCCTGGTGATAAGTGCTGGAACTGCTAAAAATACGGTCATTGAAAAAAGCCA
AAAAAACTCACCGACCCAGCCAGTTTTATCATTCATCATAACATCTTCGCTTTTTACATG
GCTAATGAATGCAAAGACAGACGCAGAAGCTATAGTAGAGACCGCATGAGAAAAGAAGGT
CGCTGCTATAAGTGTGGAAAGAAAGGACACAAGCAACGCGATTGCTCAAGAGGTAGATCA
AGCTCTGGTTCTTCAAGATCAAGATCTAGCTCATACTCAAGCAGAAGAAGTAGAGACAGA
CATCACAGAGATAGCAGAAGAAGAGACGAAAGAGATAGAAGAGACCGTGATAGAGGTGGT
AAAAGAAGATCTCCATCACCCAGTGAATCCAGAACTCCAAGCAGAGAAAGAGGTAGAAGA
AGAAGCAGAAGCAGAGACAGTAGATCTCCATACTCCAGAAGCGATTCAAGACGTAGAAGT
CCATCAAGTGACAGGGGTAAATCAAGAGACAAATCAGCTGATAAATCAAGAGGCAGATCA
GCTAGTAACAATAGAAAGTCAAAGTCACCACATAGTCCTAAATTTAGCCCCAAAAAGTCT
AGATCTCCTTCGGGTGATAGAAATGGAAAGGCTGCATCCCTTGATACTAATGGAGTCAAA
CCAGAAGAAAGCACATCAGCAAATAATAGAATTGAAAATGCTGAAGCAGACACCATCCCT
AAGGAGTGA


>Contig4371.0.g71(protein)
MSRNPQIYVGGVSRRTHPEDLEKAFEKYGKIRSFSFKAKYAFIEYDDYHDARDAIERMDG
KSFDGERLIVEHTKEGRGRRGPSPGDKCWNCQKYGHXKKPKKLTDPASFIIHHNIFAFYM
ANECKDRRRSYSRDRMRKEGRCYKCGKKGHKQRDCSRGRSSSGSSRSRSSSYSSRRSRDR
HHRDSRRRDERDRRDRDRGGKRRSPSPSESRTPSRERGRRRSRSRDSRSPYSRSDSRRRS
PSSDRGKSRDKSADKSRGRSASNNRKSKSPHSPKFSPKKSRSPSGDRNGKAASLDTNGVK
PEESTSANNRIENAEADTIPKE