Identifiers and Description

Gene Model Identifier

Contig10974.0.g36

Standard Name

NOT11b

Aliases

Contig10974_0_g36

Description

Uncharacterized conserved protein (DUF2363)

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( pfam10155 ) Uncharacterized conserved protein (DUF2363)
  • ( pfam08472 ) Sucrose-6-phosphate phosphohydrolase C-terminal

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_004733501.999598840915195e-17Ubiquitin family protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig10974.0.g36(coding)
ATGTTGAATACTCAAGAACTGTAATAGCTTTAGTTTGTGCTTTCGGATCCAACCAAGACT
TTCGAATAGTGTTTACAGTAATTTTTAAAGTTCAGTAAGCCAGAACAATTCAGAGCATGC
TGTACTCTATGCTAACTCCTAGAAACTAATCAATTGTCAAAGAGTCAAAGAATAATTGCA
TTCTATATTCTGTATCAATTATATAGACATGAAAATGTAAGCTCCACTCCTTTTGAAGCT
GTGGTGTTAAGTTCATTCCAAACCTGTTTGCATCACATCAATACTGCCACAAATTAAGTT
GGAGAGGAAAATTAATTGAAAGCTGAGTTCAAACTCTTGACAGATTTCTTAGTCTCTATA
CCAAAGATGAGCAAGCAGCAGATTTATTAATACATCTAAGAAGTTGAGAATAGCAAGGAT
CCAGTTGAAGTCCCTATTCCAGACATTAATCAATACATTAAGATCTATTAAGAAAAGATG
CCAAAATTGAGTGGTCCCAAAGCTTTTTCAATTACAGGAATATTGTAAGATTATGACGAT
TAGGAAGAGTATGCACCCCCTGAATCAGGGATACCATTTGATCAAATTGGAGAAGACGAA
CTCTAGTCTCACTATTTCCCACCTAACATATTACGACCACTTCCCGTTGAAGAGTTAGAG
CCAGCTGATAGTGGATATGACGACATGGAGACATTTTGGCTTGTTCCAGGAATGCTACCT
GAACCTTACTGGGACTTTAATATGGGTATGGATTTTAACTACTATCAAATGAGACAGCTA
TTAAACTTGGCCGTGAAAACCTAGCTTAAGGATGAAGAACAGAAAAAGCTTATCAAGGGA
TTAAAAACAGACCCAGAGCTTGTATTTCACATAAGAATGACACCTCAAAAACTTCCATCT
TTAATTATGAATAACCAGCATATTGCTTTGGAATTGCTAATCTGTATGACTACCACTATG
CGTATCACTGACTATTACGATGTGCTCTCATCTATGAAACTCAGCTCAAATTCAATTGAA
GTTTTCAATAGACTATCAAATACAGTGGAACTCCCTTAAGAGTTTATTCAAGTCTTCCTT
AAGAATTGTATGGGACAGTGCATAAACAGCAAAGAAAGCAAAGTGAATAAAAACCGTATG
GTTCGTTTGGTGTGTGTCTTTTTGCAGTCAATCATAAAAACCAAGCTGATTAGTCTTCAA
GATTTATCAATCGACGTTCACAAATTCTGTGTGGAGTTCTCGCAAGTTAAACATGCTAAC
GAGTTACTCAAGGATTTGCAAATTGATACATTTAAAACAACCACTCAATAGAATGCCGGA
AATTGA


>Contig10974.0.g36(protein)
MLNTQELQQLQFVLSDPTKTFEQCLQQFLKFSKPEQFRACCTLCQLLETNQLSKSQRIIA
FYILYQLYRHENVSSTPFEAVVLSSFQTCLHHINTATNQVGEENQLKAEFKLLTDFLVSI
PKMSKQQIYQYIQEVENSKDPVEVPIPDINQYIKIYQEKMPKLSGPKAFSITGILQDYDD
QEEYAPPESGIPFDQIGEDELQSHYFPPNILRPLPVEELEPADSGYDDMETFWLVPGMLP
EPYWDFNMGMDFNYYQMRQLLNLAVKTQLKDEEQKKLIKGLKTDPELVFHIRMTPQKLPS
LIMNNQHIALELLICMTTTMRITDYYDVLSSMKLSSNSIEVFNRLSNTVELPQEFIQVFL
KNCMGQCINSKESKVNKNRMVRLVCVFLQSIIKTKLISLQDLSIDVHKFCVEFSQVKHAN
ELLKDLQIDTFKTTTQQNAGN