Identifiers and Description

Gene Model Identifier

Contig10974.0.g35

Standard Name

NOT11a

Aliases

Contig10974_0_g35

Description

Zinc-finger double-stranded RNA-binding

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Domains

  • ( pfam12171 ) Zinc-finger double-stranded RNA-binding
  • ( pfam12756 ) C2H2 type zinc-finger (2 copies)
  • ( pfam12298 ) Eukaryotic mitochondrial regulator protein
  • ( pfam12874 ) Zinc-finger of C2H2 type
  • ( pfam06220 ) U1 zinc finger
  • ( pfam04988 ) A-kinase anchoring protein 95 (AKAP95)

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_009543301.000382677035467e-28hypothetical protein
SGDYLR074C5.0013199114200274e-20BUD20 SGDID:S000004064, Chr XI
I from 282456-281956, Gen...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig10974.0.g35(coding)
ATGGGAAGAGTTGGAAGAAAAGGAAACTTTTAAAAGAACAAGAAAATCAACAGAGATAAG
GTGAAGAGACCCTACAAGCGTGACATCGATCAAATAGTTTTCGAAGATTTGATCCCTGAG
AACACCCAGAAGCTTCTAAATCAAGCAATCAACGAAGACTTGCCAGGTTTAGGTCAGCAT
TACTGCGTGACATGCGCTCGCTATATGATCAACGATAAAGTCATGCAAGTACATTTGAGA
ACTAAAGAACACAAAAAGAGATTCAAGATCATTAAGAACGATACACCCTACACTCACGAA
GAAGCCGAGAGAGCTGCAGGACTCAGACCAGCCAAGAAGAGACAATGA


>Contig10974.0.g35(protein)
MGRVGRKGNFQKNKKINRDKVKRPYKRDIDQIVFEDLIPENTQKLLNQAINEDLPGLGQH
YCVTCARYMINDKVMQVHLRTKEHKKRFKIIKNDTPYTHEEAERAAGLRPAKKRQ