Identifiers and Description

Gene Model Identifier

Contig14141.0.g95

Standard Name

NOP58

Aliases

Contig14141_0_g95

Description

Putative snoRNA binding domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_000505903.998941839720987e-159SnoRNA binding domain containi
ng protein
SGDYOR310C9.997217559668329e-127NOP58 SGDID:S000005837, Chr XV
from 898360-896825, Geno...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig14141.0.g95(coding)
ATGTACGTTCTATTCGAGACTCCAGCTGGTTTTGCTCTATTCAAGGTCCTTAAGGAAGGA
AAGCTAAAGGATGTTAGCAATCTTTACAAGGAATTCGAAAACCCAAAGAAAGCTGCTGAG
ATGGTTAAGCTTAAGGCATTCAAAAAATTCAAGGATACCAAAGACGCCATGAAATCAGTT
GAGAAGCTCCTTAAGGGAGAAATAAGCAAAGGTCTTAAGAAGTTTTTGGACAAGAACATC
GTTCAAAAAGGTATTGAGGAAGAACTTATGATTTCAGATAAGAAACTAGGTAAATCCATC
ACTGAAAAGTTGGGAATTGAGTGCAAAGCCGGTGAGAAAGCTAGTGAATTAATCAGATGT
GTCAGATTCCAAATGACCTCTCTTTTGGAGGATCTTGACGAGAAGGAACTCAAGAGCATG
AGTTTAGGTCTTGCTCATTCTTTATCAAGATATAAACTCAGTTTCTCATCAGAGAAAGTT
GATACCATGGTTATTCAAGCCGTCTCATTGTTAGAGGATTTGGATAAAGAACTGAACAAC
TACGCTATGAGACTAAAGGAATGGTATTCATGGCATTTCCCTGAGTTGGCCAAGATTGTT
ACTGACAATATTACCTACTCACAAATGGTTGATTTGATTGGAATGAGACAAAACGTCAAG
AAACTTTCAATCGAAAAAATGACTGAAATCCTTGGAAATGAAGATATCGCTCAAGAAGTT
AAAGAAGCTGCTGAAATCTCTATGGGTACTGAAATTCTTACTGAAGACGAAGAGCACATT
AGGTCTCTCTCTAAGTCAGTTTATGAAATTTCTCAATACAGACAAAACTTGGCTGAATAT
CTCAAGAACAGAATGGCTGCTATCGCCCCAAATCTTACTCAATTGATTGGTGAGCTCGTT
GCCGCTAAGCTTATCTCACACGCTGGCTCTTTAATGAACTTGGCTAAGCTTCCAGCCTCA
ACCATTCAAATCTTAGGAGCTGAGAAAGCTCTCTTCAGAGCCTTGAAAGCCAGAAAGAAC
ACTCCCAAGTATGGTCTTATTTATAATGCCTCAATCGTTGGTGCCGCTAAGAACCAACTT
AAGGGTAAGGTTTCAAGAACCTTAGCTAACAAGTGCGCTCTTTGCGTTAGATACGACGCT
CTTGGTGAAGATGTTGAAGGCAACCTCGGTATGAAGAATAGAGCTTACCTTGAAGGTAGA
GTTAAGTTGCTTGAAGGAGGTGGAAAAGTCATTCAACAAAACGGTGCTGGAGGACAAAAG
AAATGGTAAGCCAAATCAGATAGCAAGGGATACAACGGAGCTGAAGATTTTGTCGAGAAG
AAGAGACAAAGAACCGAATGA


>Contig14141.0.g95(protein)
MYVLFETPAGFALFKVLKEGKLKDVSNLYKEFENPKKAAEMVKLKAFKKFKDTKDAMKSV
EKLLKGEISKGLKKFLDKNIVQKGIEEELMISDKKLGKSITEKLGIECKAGEKASELIRC
VRFQMTSLLEDLDEKELKSMSLGLAHSLSRYKLSFSSEKVDTMVIQAVSLLEDLDKELNN
YAMRLKEWYSWHFPELAKIVTDNITYSQMVDLIGMRQNVKKLSIEKMTEILGNEDIAQEV
KEAAEISMGTEILTEDEEHIRSLSKSVYEISQYRQNLAEYLKNRMAAIAPNLTQLIGELV
AAKLISHAGSLMNLAKLPASTIQILGAEKALFRALKARKNTPKYGLIYNASIVGAAKNQL
KGKVSRTLANKCALCVRYDALGEDVEGNLGMKNRAYLEGRVKLLEGGGKVIQQNGAGGQK
KWQAKSDSKGYNGAEDFVEKKRQRTE