Identifiers and Description

Gene Model Identifier

Contig20979.0.g106

Standard Name

NOP56

Aliases

Contig20979_0_g106

Description

Putative snoRNA binding domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_005580401.000274544751666e-156SnoRNA binding domain containi
ng protein
SGDYLR197W9.002462150144689e-141NOP56 SGDID:S000004187, Chr XI
I from 546097-547611, Gen...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig20979.0.g106(coding)
ATGTAGCTTTTTATCTTATACGAGAGTGCTTCAGGGTACGCCCTTTTCGAAAAGGAAGAT
TTCGACGAATTAGGAGGTCAACTCAAGGCCATCCAAAAATCAATTTCCAGTTTAGAGAGA
TTCTCTAAGATGGTTAAATTGGCTGCTTTCCAACCATTCCAAACTGCTGAGGAAGCTCTT
GAAAACATTCAAGCTATTGCTTAAAACAAAGTAGCAGAGACTCTCAAGAATTTCTTGATC
ACAAACCTCCCAGCCACTAAATCCTCAAAGAAGCAAAAGTTCTTACTAGGTATTGCTGAG
CCAATGATGGGACAACAAGTATTCGCTGAAACTGGAATTACTGCATCTTACAACGAATCA
ATTGAAGAGCTACTCAGAGGTATTAGAACTCACCTCCCAAAGATCTTGAAGAAGGTCAGT
GAGGAAGATACCAAGAAAGCTCAACTCGGTCTTGCCCATTAATACTCAAGATTCATGTGC
GCTGCTGATGTCAACAGACAAGACAAGCCAATCATCCAAGCTATTGCATTGATCGAAACT
ATGGATAAAAATATTAATACATTCTGTATGAGACTTAAGGAATGGTTCTCATGGCATTTC
CCTGAGCTTAGCAAGATTGTTAGCGACAATCTTATTTTCTCTAAGTTAGTGCATTTCATT
GAAAAAAGAGAGAATATTAATGAAGATATGAAGGACGGTCTTGCTGCTATCGTTTTAGAT
GAAGACAAAGCTCAAGAAATTATTGAGGCCGCTAAAATCTCAATGGGACAAGAGATGTCA
GAGACTGATGTTCTCCAAGTTAAGAGCTTCTCAGAGAGAGTTGTTGAATAAATTGAATTC
AGAGAGAGACTCCAAGAGTATCTTAGAACTAGAATGAATGCAGTTGCACCAAACTTGACT
GCTCTTATTGGAGAAATCGTTGGATCAAAACTTATCTCTCACTCAGGTGGTCTTACCAAC
TTGGCTAAGTATCCAGCTTCTACCATCCAAATTTTGGGTGCTGAAAAGGCTTTGTTCAGA
GCCTTGAAGACTAAGGGAAAGACTCCAAAGTATGGTCTTATTTTCAACTCATCCTTCATT
GGAAGAGCTGGCCAAAAGAACAAGGGTAGAATTTCCAGATATCTTGCCAATAAATGCGCT
ATTGCTGCAAGAATCGACTCCTTCACTGAAGGTACTCATTAAACCAATCTTTTCGGAGAG
AAACTTAAGAGTCAAATGGAAGAGAGACTCCAATTCCTCGCTTCAGGCGCTAAGCCAAAG
AAGAACACTGACGCCATGAAGGAAGTCATTGATGAGCTCAAGAAAGAGGGTCTCTTCTAC
GACGGTTCAGCTGCTGGCAAATCAAACGGAACAAAGAAAGACAAAAAGAAGAAAGTTGAC
TCCGATGTAGAGATGGAATCAGAGGACGAGAAAGAGAAGAAGAAAAGTAAGAAAGATAAA
AAGAAGAAGGACAAGAAGAGAAAGACCAGAGACAGCAGTGACGAAGAGTCAGAGGAGGTA
GAGAAGCCAAAAAAGAAGAAGCAAAAGCTCTGA


>Contig20979.0.g106(protein)
MQLFILYESASGYALFEKEDFDELGGQLKAIQKSISSLERFSKMVKLAAFQPFQTAEEAL
ENIQAIAQNKVAETLKNFLITNLPATKSSKKQKFLLGIAEPMMGQQVFAETGITASYNES
IEELLRGIRTHLPKILKKVSEEDTKKAQLGLAHQYSRFMCAADVNRQDKPIIQAIALIET
MDKNINTFCMRLKEWFSWHFPELSKIVSDNLIFSKLVHFIEKRENINEDMKDGLAAIVLD
EDKAQEIIEAAKISMGQEMSETDVLQVKSFSERVVEQIEFRERLQEYLRTRMNAVAPNLT
ALIGEIVGSKLISHSGGLTNLAKYPASTIQILGAEKALFRALKTKGKTPKYGLIFNSSFI
GRAGQKNKGRISRYLANKCAIAARIDSFTEGTHQTNLFGEKLKSQMEERLQFLASGAKPK
KNTDAMKEVIDELKKEGLFYDGSAAGKSNGTKKDKKKKVDSDVEMESEDEKEKKKSKKDK
KKKDKKRKTRDSSDEESEEVEKPKKKKQKL