Identifiers and Description

Gene Model Identifier

Contig19053.0.g61

Standard Name

NOP53

Aliases

Contig19053_0_g61

Description

Nop53 (60S ribosomal biogenesis)

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( pfam07767 ) Nop53 (60S ribosomal biogenesis)

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_005817709.997764199084386e-16hypothetical protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig19053.0.g61(coding)
ATGTAAAGCAAAAAGAAACAGTGGGCAAAGGCCATCGACTAAACTGAGCTCCTCAGAGAC
ATTGAGAATCACAACACTCAAAAAGCTATGACTCAGAAATTGACAACAATGAAAGATGAG
GATCTATTCACAGTGAATGCTAAAAAGTAAAATGTGAAGGGAGAGAGAGAAAAGTTGAAG
AGAGATAGGTTCAAGGAGAAGGAAAAGATCTACACCTCCAAGACTGAGCAAGATTTACTC
AAGAGGTTTATCTTGAAACAAGAGAGAAATCAGAGCACTGGATAACATGTACAAAAGAAA
AAGAGCGAGTCAGAAGATGAAGATTTAGATATTTGGAATTCCTCATCCACAACTGCATCG
ATACCTAGAAAAATCACAACCACATTTACTTCCGTCCCAGCCAGAATTGAGATCCCAAAG
CAAAAGGGTAAGAACTTTGGAAAATTCCAGGAATACAAGAAGAAAAAAGACATCAAAGTT
AAAGCTGTTGTGGTACCCCTAGGTGGTCAGAGCTACAATCCAAGCGCCAAGGATCATAAG
GAAGTCATTTAGAAAGTTATTGCATAAGAATTCGAGGAGGTCAAGGAAGTTGAACGCAGA
ATGAGACATCTTTAACCATACCTTTTTGAGAAAGAAAATGCAAGTGTAGCTGCTAAGAAA
GCTGCAAAGCAGAAGACAATTGATGACGCTAGTGACGATGACGAGCCTGAACACGACTCC
GACAACGAAAACGGTCTCGAAAGAACTAACAAAGCCGTAGACAGATTGAACAAGCTCACT
AAAACAGAGAAAAATGCTAGACTTATCAAGCAACTAAAGCAAAAAGAGCAATAGAGATTA
AGAAAAGTGAAGCAGCACGAGAAAAGTTTCGAGAAATTGCCCATGTTTATCTAACAAGAT
GAAAACATTAAGAGAAGAATGGTCAATAATGTAAAGAGAAGGACGAGAGAGGCTGATTAA
GAGAAACAGGTACAGGAAAAAGTCGGTATTGTCAACAGAGCTGCTAAGCTTGGAAAGTAT
AACTATAAGATGAAGAAGATTGATTTCCAGACTGAGGAGGAACTTGCTGGTAACTTGAGA
TAGTTGAAACCAAGAGGCCCTGCTGATCTATTGGTTGATAGATACGATTCTATCTTCCGT
CGCAGAATGCTCGAGCCTGATGAACCACTAAACTCAGACAGAAAGAGAATCAAGAAGGCC
AAGTACAAGTGGCATCAAAGCCAGGGTGGAAAGATGGCTGACAAAATGGCCAGGAAAAAC
GAAGAGAGAAAGCAAAAGAACAACAAGAAAGGTATGTCAAGCGATCAAATGCTTCAAAAC
GATCTAATCCTAATCTGA


>Contig19053.0.g61(protein)
MQSKKKQWAKAIDQTELLRDIENHNTQKAMTQKLTTMKDEDLFTVNAKKQNVKGEREKLK
RDRFKEKEKIYTSKTEQDLLKRFILKQERNQSTGQHVQKKKSESEDEDLDIWNSSSTTAS
IPRKITTTFTSVPARIEIPKQKGKNFGKFQEYKKKKDIKVKAVVVPLGGQSYNPSAKDHK
EVIQKVIAQEFEEVKEVERRMRHLQPYLFEKENASVAAKKAAKQKTIDDASDDDEPEHDS
DNENGLERTNKAVDRLNKLTKTEKNARLIKQLKQKEQQRLRKVKQHEKSFEKLPMFIQQD
ENIKRRMVNNVKRRTREADQEKQVQEKVGIVNRAAKLGKYNYKMKKIDFQTEEELAGNLR
QLKPRGPADLLVDRYDSIFRRRMLEPDEPLNSDRKRIKKAKYKWHQSQGGKMADKMARKN
EERKQKNNKKGMSSDQMLQNDLILI