Identifiers and Description

Gene Model Identifier

Contig3524.0.g37

Standard Name

NOP2L

Aliases

Contig3524_0_g37

Description

NOL1/NOP2/sun family

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( pfam01189 ) NOL1/NOP2/sun family
  • ( pfam13847 ) Methyltransferase domain
  • ( pfam01209 ) ubiE/COQ5 methyltransferase family
  • ( pfam05175 ) Methyltransferase small domain
  • ( pfam13659 ) Methyltransferase domain
  • ( pfam08704 ) tRNA methyltransferase complex GCD14 subunit
  • ( pfam01135 ) Protein-L-isoaspartate(D-aspartate) O-methyltransferase (PCMT)
  • ( pfam09445 ) RNA cap guanine-N2 methyltransferase
  • ( pfam13649 ) Methyltransferase domain
  • ( pfam12847 ) Methyltransferase domain

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_004996103.000712232670428e-104NOL1/NOP2/sun family protein
SGDYNL061W0.000000000000020000882446601127NOP2 SGDID:S000005005, Chr XIV
from 510540-512396, Geno...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig3524.0.g37(coding)
ATGCTAAAAAATGCAATGAAAATAAAGCAAAGGATGAATTTGCCAACTCTTAATGCAACA
AGAAAGGCTTATATATTAAGAATTTTAGATACTTTTGATTAGGAACATATCAATAATCCA
GGCAGAAATATCCCATTAGATTTATACTTGAGATACTTCTTTTTGAATGAAAAAAAGAAA
GTTGATGGGTTTGATAGAGAGTCTATAGTAGACTATGTATACAATTTGATGATGTATAAG
GGCTACCTAAATGCGATTTGTAAAAAACCAATGACTTGGGAAAGTAGATTTAAAGCATTT
TTATCTCCAGATTTTGAAGAACAAATAACAAATGAAGGCTTACCTGAGCATGTGAGGTTA
AGTTTTCCTAAGGATTTGTTTGATGAAATAGTCAAGGCTCATGGACCCTAAGAAGCTGAA
GAAATTTGCAGAGTTTAAAATGAAAGAGGGTTACTTACTTTAATGAGAGCATTCAAGCAG
AATGGATGGAAAGTCTAACCTACTCAATTTGCACCTCATGGTATAAGGTTCATCCAAAAA
CCTTAAGGAAATTTCTTCGCAATGCAAGAATTCAAGGAGGGTAACTTTGAAGTATAAGAT
GAAGCATCTCAACTACTTTCAATGAGAGTGGACGCAAAACCTGGCGATATAGTTTTGGAT
TATTGTGGTGGATCTGGTGGCAAGACTCTAGGTTTTGCACCCTTTATGCACAATAAGGGT
CAGATATTTATGCACGACATTAGAAAAAGTGTGTTGATTCAAGCTAAATAGAGATTTAGA
AGAGCTGGTATATAAAATGTTCAAGTTCATCATGATAAGGAGAAGCTTAGATCAGTGCTT
AAAGAGAAATGCGATTGGGTCATGCTTGATGTTCCTTGTACAGGAACTGGTGTTATGAGA
AGAAATCCAGATTTAAAGTGGAAATTTAGTGTTGAGAAAATGAGAGAAACAATCAAAGTC
TAAGAAATTATTTTGGATGAAAGCTTACATTTCCTAAATCCAAAGAAAGGTAAAATAGTA
TATTGCACATGCAGTGTATTGCCAGAGGAAAACTTGCTTTAAGTTATTAAATTTTGTGAT
AAACATGGTTTTGAAATCGAGAACGGTTCTCATTTTACAACTTATCCTAAAAATAGAGGC
ATGGATGGATTTTTCTCAGCTACTTTAATTCCTAAAGGAACTCAGAAATCGTTAATTAAA
TGA


>Contig3524.0.g37(protein)
MLKNAMKIKQRMNLPTLNATRKAYILRILDTFDQEHINNPGRNIPLDLYLRYFFLNEKKK
VDGFDRESIVDYVYNLMMYKGYLNAICKKPMTWESRFKAFLSPDFEEQITNEGLPEHVRL
SFPKDLFDEIVKAHGPQEAEEICRVQNERGLLTLMRAFKQNGWKVQPTQFAPHGIRFIQK
PQGNFFAMQEFKEGNFEVQDEASQLLSMRVDAKPGDIVLDYCGGSGGKTLGFAPFMHNKG
QIFMHDIRKSVLIQAKQRFRRAGIQNVQVHHDKEKLRSVLKEKCDWVMLDVPCTGTGVMR
RNPDLKWKFSVEKMRETIKVQEIILDESLHFLNPKKGKIVYCTCSVLPEENLLQVIKFCD
KHGFEIENGSHFTTYPKNRGMDGFFSATLIPKGTQKSLIK