Identifiers and Description

Gene Model Identifier

Contig15557.0.g115

Standard Name

NOP2

Aliases

Contig15557_0_g115

Description

NOL1/NOP2/sun family

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_003019501.9994671418645758e-169NOL1/NOP2/sun family putative
RNA methylase c...
SGDYNL061W6.002643599093603e-161NOP2 SGDID:S000005005, Chr XIV
from 510540-512396, Geno...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig15557.0.g115(coding)
ATGAGCAGCAGTGAAGATGACTATGATGAACAAGTGAACTCATCTCAAGAGGAAGAAGAG
GAAGATGATGACATTGAAATGGAAGCAGGAAGTGAAGATGATGAAGATTTAGACGATGAA
GGTTTAGAAGATGATGAAGATGGCGAGGAAGAAGGATCTGATGATGAGGAAGAAGGAGAT
GATTCAGAAGAAGATCTAAAGCCAAAAGTTAAGCAAGCTAAATAAGGCAAGAAAGTGCAA
AGCACTGAAGAAGAGGAAGACGATGGTGAGGGTTATGATGATGATATAGCCGATGAAGAG
GCCATCACCAACATTGAAGCCAAGAGAGATAAGATGATCAGTGACTTATTGAGCAAGGAG
GATCTCGGTATTATACAGATGAGACTAAAAGAAAATGTCAAGGTCTTGACAAACTTCAAA
GACTTGAGAGACCCAAACAAGTCAAGATTAGACTACCTAGAAGAAGTTAGAAATGATATC
TGCTCTGCCTTCGATTACAATCCAGATCTTGTTGAGCTTCTTCTAGATTTATTCCACCCA
AGTGAATGCCTTGAATTCATTGAAGCCAATGAAAATCAGAGACCAATGACCATAAGAACA
AACACTCTTAAAACCAAGAGAAAGGATCTTGCTAAAACATTGATTCAACGTGGTGTCAAT
CTCGACCCAGTCGCTGAATGGTCAAAGGTAGGCCTAAAGATATACGATTCTGCAGTGCCT
ATTGGTGCTACTCCAGAATATTTAGCTGGTCACTATATCTTGCAATCAGCATCCTCATTC
TTGCCAGTAATTGCACTCGCTCCATAACCTAATGAAAAGATATTAGATATGGCTGCAGCA
CCAGGAGGTAAAACTACCTACATTGCCCAGTTAATGAAGAACACAGGAGTCCTTGTTGCA
AATGACCTTAAAAAGGAGAGACTTAAGTCACTCAATGCTAACCTGCACAGATTAGGAGTA
ACAAACACAGTCGTAATTAATCACGATGGTAGAAAGATCCCATCACTTTACACTAAATTT
GACAGATGTTTGTTAGATGCACCATGCTCAGGTTTAGGAGTTATTGCCAGAGACCCTTCA
ATTAAGGTCCAAAAGACTAGAGAGGATGTGAAGAAGTTATCTCATTTACAGAAGGAACTT
ATCAAAGCAGCTATTGATATCGTAGATGCTCACTCCAAGACTGGAGGTTACATTGTTTAC
TCAACATGCTCAATTTCAGTAGAAGAAAACGAGTGGGTCGTTGACTACGCCCTGAAATCT
CGCTATGTTAAACTAGTGGAGACTGGAGTCGAAATCGGAGAGCCAGGTTTCACCAAGCAC
AAAGAAAAGCGTTTCCACCCATCACTCAACTTGACCAGACGTATCTATCCTCACACTCAC
AACATGGACGGTTTCTTCGTTGCCAAATTCAAGAAATTCGCTAATGGTGAGAAGAAATAA
GAGGATGAGCAGAAGACCCCTGAGGAAATCGAGAGACTAGTGAAGGAGAAAGAAGTGCAA
AAGAAGAAGATGCAGAACCTCAAGAAGAAGAACCAGAAGAAAAACAAGAAGGCTAAGGTA
CAAAAGGAGATAGAGGTCAAAGAGAAGAAAGAAGCAGATAAAAAGCAACTAAAGATTGAG
GCAATAGCCAGAAGAGAAGCAAATGCTGAGAAGAGGGAAGCAAACGCAGAGAAGAAGGAG
GGAGATAAGAGTGACAAGCAAGATAAAAAGAAGAACGGTGATAAGAAAAAGAGACAGGCT
GAGACCAGTACTGATAAATTAGAGTCTAAAGTCAACAAACCAGCTCAATAAAAGGAAGAT
AAGCAACCTGCCAAGAAGGATAAACAACCTGCTAAGTAGGATAAACAACCTGCTAAGTAG
GAGAAAGAACAGCCCACAAAATAAGTCAAGGATCAACAACCACCCAAGCAGGACAAACAA
CAATCAAAGCCTTAATAACAACAACCAGCAGCTAAATAAGAAAATAAATAGAAAACTCCA
CAACAACAACCAGCAAAAGAGGCAGAGAAATAATAATAACAATAAAAACCTAAGCATCAA
GATAAGCCAAAGCAAAAAGAGGCTGAACCACAACAAAGTGTAAAGAAAGCTGATGCTAAA
GCACAGGATAAACAGAAGAAGAAGGACAAGAAGAATAAGAATAAATGA


>Contig15557.0.g115(protein)
MSSSEDDYDEQVNSSQEEEEEDDDIEMEAGSEDDEDLDDEGLEDDEDGEEEGSDDEEEGD
DSEEDLKPKVKQAKQGKKVQSTEEEEDDGEGYDDDIADEEAITNIEAKRDKMISDLLSKE
DLGIIQMRLKENVKVLTNFKDLRDPNKSRLDYLEEVRNDICSAFDYNPDLVELLLDLFHP
SECLEFIEANENQRPMTIRTNTLKTKRKDLAKTLIQRGVNLDPVAEWSKVGLKIYDSAVP
IGATPEYLAGHYILQSASSFLPVIALAPQPNEKILDMAAAPGGKTTYIAQLMKNTGVLVA
NDLKKERLKSLNANLHRLGVTNTVVINHDGRKIPSLYTKFDRCLLDAPCSGLGVIARDPS
IKVQKTREDVKKLSHLQKELIKAAIDIVDAHSKTGGYIVYSTCSISVEENEWVVDYALKS
RYVKLVETGVEIGEPGFTKHKEKRFHPSLNLTRRIYPHTHNMDGFFVAKFKKFANGEKKQ
EDEQKTPEEIERLVKEKEVQKKKMQNLKKKNQKKNKKAKVQKEIEVKEKKEADKKQLKIE
AIARREANAEKREANAEKKEGDKSDKQDKKKNGDKKKRQAETSTDKLESKVNKPAQQKED
KQPAKKDKQPAKQDKQPAKQEKEQPTKQVKDQQPPKQDKQQSKPQQQQPAAKQENKQKTP
QQQPAKEAEKQQQQQKPKHQDKPKQKEAEPQQSVKKADAKAQDKQKKKDKKNKNK