Identifiers and Description

Gene Model Identifier

Contig17597.0.g49

Standard Name

NOP14L

Aliases

Contig17597_0_g49

Description

Nop14-like family

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

No Data fetched for Homologs

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig17597.0.g49(coding)
ATGCCCATATTTGAAGAAATGGCTGATTTCGATGATCTCAAGATGGAGTTCCTAATGAAG
TTGCAGACTTAAGATTATGTGAGCGCACAAGCAATCCAGAGGCAGCTCCTGAAACTGCAA
CCCCAAAACAAGTTAATCCAGGAGTTCAGTTCCCTCTTACCAGATGAAGTTGCTGCACAG
AAAGATGCATAAGGTCAGGAGGAGTATGGCGATGAATATTACGATGAGGAGGAGGATAAA
GAAGAGGAGAAGGAGGAAGAAGAGGATAAGGATGATGATGAAGAGGAAGAGAAGAAAGAT
GTAGAGGAAGAGAAGAAAGAGGAGGATAAGAAAGAAGGCGATGATGAGTATGATGAAGAT
GCCTATGGCGAGGAGGACTACGATGAAGAGGGCAAATATATCTGGGGTAAGGAAGGCGCT
GAGTGGGATTTCTATTACAAAGAGGATAAGGATGCCTTCGAGAGAGGTGATCCAGTGCAT
CCTGCTGTAATCAATACTAAACCCATTAGAGACACCACTGCTATTAAAGATGATGATGGA
ATAAGTCTTGCTTCCACTGCAACTGGCAGCAGTAACGGCATGTATAAAACCAAAAAGAAA
GCTGCTGCAGGTACTTGGAAACCACAATGA


>Contig17597.0.g49(protein)
MPIFEEMADFDDLKMEFLMKLQTQDYVSAQAIQRQLLKLQPQNKLIQEFSSLLPDEVAAQ
KDAQGQEEYGDEYYDEEEDKEEEKEEEEDKDDDEEEEKKDVEEEKKEEDKKEGDDEYDED
AYGEEDYDEEGKYIWGKEGAEWDFYYKEDKDAFERGDPVHPAVINTKPIRDTTAIKDDDG
ISLASTATGSSNGMYKTKKKAAAGTWKPQ