Identifiers and Description

Gene Model Identifier

Contig7322.0.g25

Standard Name

NOP14

Aliases

Contig7322_0_g25

Description

Nop14-like family

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_005846700.0000000020002373268528243hypothetical protein
SGDYDL148C0.00000030014504373857585NOP14 SGDID:S000002307, Chr IV
from 190586-188154, Geno...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig7322.0.g25(coding)
ATGGCACACAAGGGAGGAAAAGGCAAAGGAGGCAACAAGCTCAAGAGAAAGAGAGGAAAG
AAGTTCAGATTTATGGATGGAGAAGGAGATGGAACTCAAGTAGGTAAAGGCAAGTAGACT
GAGGGAAATCCATTCGAAGATCATCACTCATCTAAAAAGGCAAATAAGGACAAGTTAAAG
AGAGCTCAACTGATTAATGAATTCCAAACCAGAGGCAAGAACAATGTATTTATTGACAAG
AGAATCGGAGTGACTTCTTCTAAGCTATCTGAAGAAGACAAAATGAGATTGAGATATATG
CGTGAGCAGAGAGATCAGCTTAAGTTAAGCAAAGTCAGCAAGAAAAGAGCAAAGTACAAT
CTGGATGACCTCAATTCTGAAGAGGAGGAGAATGACATGTTTATGGGATTCACTCACGGA
GGCAGAAGGTTAGAGGAGATGGACGATTTCTAAGATAAAATTGAACTGTCTTCTGATGAA
GAGGGTGGCTACGAAGATCGCCAAGATAGAGACAAAAGAATCGGAAATTTGGATGAGCAA
ATGGTTATGAACATGAACTTCGGAGGAGGAGCATTCTCAGGCGATGTTAGAGATAAAGAT
CAAAAGAAAACTCGTAAAGAAATCTTTGAGGAGATCATCGACAAATCCAAAGCTTACAAA
ATGGTTAGAAGTGAAATTAAGATAGCTACCTAAGACCTTTCTGCTAAACTTGACACTGAA
TATTTCGATTTGCTACCACTCCTGAACCTTAATAAAAACAAATCTGCTTAACGTGTAATT
GAAGACACCAAGCTTGACAAGTCCTATGAAAAGCTCGCCAGCATGATGGTCGATTAAAAG
AGAGCGCAACCCATTTAAGTGTTAATGAGCGACAAAGAACAAGCCAAACAGAAGAAAGCC
AAGTTACAAGCACTGGCTAAACAGTAAAATGCAGGCAATGACTCTGATGACAGTGATAAC
CAACAATTAAGGAAGAGAGACAGCAAAATGGTTGATAAGAGGGAGTAGGCATTCAAGAAT
ATGCAGAAAGACACCATTGAAAAGTATAAGAACGACATCAAGGCAAGTATTGTTGAGGAT
AGAGTTAAGGAATAGATCAAGAAGGTACAGGAGAAGAAAGGAGGTAAATAGGTTGAAATT
GACTCTGATCTGGCTTCCGAAGATGATGAAGAGGAATATGACGAGGAAGAAGATAACGAT
GATGATAACGAAGAAGAAGATGATGATGAAGAGGAGGAAGATGATGATGATGAAGATAGT
TCATGA


>Contig7322.0.g25(protein)
MAHKGGKGKGGNKLKRKRGKKFRFMDGEGDGTQVGKGKQTEGNPFEDHHSSKKANKDKLK
RAQLINEFQTRGKNNVFIDKRIGVTSSKLSEEDKMRLRYMREQRDQLKLSKVSKKRAKYN
LDDLNSEEEENDMFMGFTHGGRRLEEMDDFQDKIELSSDEEGGYEDRQDRDKRIGNLDEQ
MVMNMNFGGGAFSGDVRDKDQKKTRKEIFEEIIDKSKAYKMVRSEIKIATQDLSAKLDTE
YFDLLPLLNLNKNKSAQRVIEDTKLDKSYEKLASMMVDQKRAQPIQVLMSDKEQAKQKKA
KLQALAKQQNAGNDSDDSDNQQLRKRDSKMVDKREQAFKNMQKDTIEKYKNDIKASIVED
RVKEQIKKVQEKKGGKQVEIDSDLASEDDEEEYDEEEDNDDDNEEEDDDEEEEDDDDEDS
S