Identifiers and Description

Gene Model Identifier

Contig16240.0.0.g101

Standard Name

NOP10

Aliases

Contig16240_0_0_g101

Description

hypothetical protein

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

No Data fetched for Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
SGDYHR072W-A 163.2

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig16240.0.0.g101(coding)
ATGTTTTGTTTTCAGAAAGACTCTATCGTCGTGTGCTTGATATTCCCCGACATGAAGCCA
GTCCCAAGGAAAGTTGTCTTCAATCCAAGAGTAGATAACTTTGAAATGCTCTAAATTTCT
GGTTTGTATGACTTGCTCGCAAACTTAACAACTACTGATTTGAGAATGTTTGCTATGTCC
AATGGAGTCATTTCCAGACCTATTCTGATCAAAAGGCAAGATAAAGTTGCTTAATTAGTA
AACTTGAGAATTGAGATGAATAATGGAGCAATATAAAAGTTAGAATGGATAAATGTATGT
GATGATCTTGCTTGTGAAAATAATATCTGTATTGATACTCAGGAGCTTTGGAGAAACACA
ACATACTATGATAGTAATTGCTTCTTATACGGATGTTCTAGCTCAGTAAATAGTCAATGC
GACACTAAGGTATATCTCACATTTATTGGAGAAGACAGAGAAGGAAGGGTTTTTACGAGT
GACAACTATAGACTTTCTAATTTTATGGATTATTCACTCAATACTCTATTTTCCAGTGCC
AAAAGCGTTGGAGGAGGAATTTACAGCAAGCTATCAAATATGTACTTGAGATATTACCTC
AACGAGAAGAAAGAAAGAGTTTACACTTTCAGCTTCTACGATCCAAGCAACAACCCAACC
ATCAGTGCTCACCCAGCAAGATTCTCCCCTGATGATCCATTCTCTGAGCAAAGAATGAAG
TGCAAGGAAAGATTCAACCTCCTCCCAACTCAAAAAGCACCCATCCAACTATGA


>Contig16240.0.0.g101(protein)
MFCFQKDSIVVCLIFPDMKPVPRKVVFNPRVDNFEMLQISGLYDLLANLTTTDLRMFAMS
NGVISRPILIKRQDKVAQLVNLRIEMNNGAIQKLEWINVCDDLACENNICIDTQELWRNT
TYYDSNCFLYGCSSSVNSQCDTKVYLTFIGEDREGRVFTSDNYRLSNFMDYSLNTLFSSA
KSVGGGIYSKLSNMYLRYYLNEKKERVYTFSFYDPSNNPTISAHPARFSPDDPFSEQRMK
CKERFNLLPTQKAPIQL