Identifiers and Description

Gene Model Identifier

Contig10776.0.g25

Standard Name

NOM1

Aliases

Contig10776_0_g25

Description

MA3 domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_001294701.9993430003514377e-39MA3 domain containing protein
SGDYLR336C3.000555717977434e-27SGD1 SGDID:S000004328, Chr XII
from 802396-799697, Geno...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig10776.0.g25(coding)
ATGGACTCTCGGGGCTTCAAAAGTTAATATAATAATGGTAGACCTGGTGGTAATGGCAGT
CAGTCTAGGAGCAAATCAAAGCCAAGCAAAGATAGCAGCAAAGTGCCGAGTAAATTTGTC
TCTAGGAAAGACCTGAGAAAACAAGCTAAACAGGATAAAAAGCAGAAACACGCTGATTAT
TTCCACAGTAGAAGCAAATCAGCAAAGGATGAATACCAACAATAGCAAGTGAGAGAGAAA
CAGCAAGAAATCCAGAAGTAAAAGCAGGCACAGTAAGAGAAACTGAGAATAGAGCAGTAA
AGCAAGAAGATTCAGTAACTTCAATAAGAGTAGAGAGATATCAAAATGGGTGGCAAGAAA
CCAGTAAAAAGGGAGGAAGTTAATGATAAAGTGCTTGGCAAGAGATTTAAGGAGGATGTC
CCTGCTAAATAAGTCAGTGAGAAGAGATAGAAAGTTGACAAGAATATCTCCAATGACCGT
CAAGAATTCCTGAAGCAAAATGAAGTGGAGAGATAGAAACTGGACATGGAGCTGAAATAC
CTAGAGAAAAAACTTGGCATTAAAGATGACAAAAAGCGCAAGAAAATTAATAAAGCCATT
GAAGTGGAGGGCTTTGGTGATGGATTTATGGACTTCTTGGATGGAATTGAAGGCAAACTG
AAGGTTGACACCAAGAAATATGAGCCAAAAGAGTATGTATTCAGTGATGGAGAGGGACCT
GAAGAGGGAGATCTTGAGAATTTAGCTGGATAAGGTGGTGCAGAAGAAAGCGATCAAGAA
GGATTTGATGAGTTTATGTCTGAAGAAGAAGATGAGAATGATGAATTAGATGAATTTGAT
GATGAAGATGAGGAAGAAGAACAGGAAGAAGAAGAAGACGAAGAAGAGGATGATGGTGAG
GATAGTTAAGGTGCTGTTGATTAAGATAATGATGATGAAGATGAAGAAATTGATAGTGAA
ATCTATGGAAATGAAGATGGAGATGAAGATTTACAGAATGGATCCGATGTTTAAGAAGAT
GATGAAGACATGAATGACAATGAGTCTAATGAAGATCAAGATGATTTTGAAGATGATGAT
GACGAAGAAGACGATGATGAAAATGAAGATGAAGAATAGATAATCCCCAAAAAATAACAA
AAAAACCCAGCACTCGAGAAGCTTATTAGATCGGTACTAAATAAAGTGAGTGAAGGTAAC
CTTGAAATTATGTTCAATCAGCTCTTGACCGAGACAAAGCCCTACTTCAAGAACCCCTTG
CAATATGCCTACTGCTACTCCAAACTTTTCATTTAAATGAACATCCAGTCAAAGCAGTAA
ATGACCTCAATATTATCAGTAAACTGTGCCTTCATAAGCGCACTTCATCGCATCTTGGGT
GACTAATTTTTCGCAACTGCTGTCCGCCAGATGTTCATTGAGTTTCAAAATTCTCACAAC
ATTTCCCTAGGCAAATAACCAATAGTAGGCCCTGCAATAGCCAAAATTGACAGCGACATG
TCTGATGCAGCTAAAGATAGAGTGAAGAACTTGCTGAATTGCTTCTTGCATTTCTTCATT
TTCCAATCTTTAAGCTCTTCACTACTCATTGATCTTATTAGACTGCTCATGAACTCTTTT
GAGGAATCTGATATCGAGGTGCTTATATTCTTACTGCATAATATCGGATTGTAATTGAGG
AAAAGTGACCCTGAGGCTATCAGAGATATCATTCAGATGTCTGAGTAGAAAAAGAATTCA
TTCGCTGTAGAACTCAAAATGATTCCTCAAGAAGACCCATCATACGATTAAATGAAGAAA
AAAGAGAGAAAGATAGGTTTCTTAAACATGGAACTCCAAGACATAAAAAATAACAAGGGC
ACTATGACTCTCCAAGTGAAAAGTATCGAACATCTCTAGACTTGGATCAGAAAGAATGCT
AAATTACAGAGTGAATTGGAGTTTCAGCCAGTTGATATGAGAGCTGAGACTATCTCGAAT
ACTTTGCAAGACGACTAAGTATTGATGAAGAAATGGTGGTTGCCACTGTCTCAACAAAAG
AATGGCTAAGATTTGTAGGGAGATTTCCAAAAACCTAAAGATTTCAAAGCAGAATCAAAG
AAAACCAATGATATTTTGGAGTTAGCTTCAAAGCAGAGAATGAACACTGATATAAAGAAA
GCAGTGTTTTAAGCAATAGCTGGAGCAGAAGATTACATCCAAGCTTTTGAGAATTGCATT
AGATTAAACCTCAAAAAGCAGCAAGAAAGAGAAATAGTGAAGGTTTTGATGCATTGTTGT
ATCAACGAAAAAGGAACATTCAACAAGTTTTATGCACTTCTGGCTCAGAGATTGATTAAA
TATCAACCATAGTCTTTTAAATACTCGCTTAAATATACACTTTGGGATTACCTCAAGACT
ATCTCTAAATTTGACATAAGATAGATTGCTAATATGGCTAGAATAATCGGATTTTTAATT
GGAGAGGGAGATGTACCATTAAATTTCCTCAAAGTTATCAATTTTGACTAAGAAGGTCTA
AGTTAGCCCATGCATTTATTCTTATTTGTTCTTTTCGATTCCATCTATGACAGTTACTCC
AAAGATCAGATTAAATCACTGTTTAAGAGAGGAATTTCAGAGAAGCATTCTGAATTCAGA
AAGGGCATTAGTGAGTATCTATTGACCAAATTCTACTTGAAAAAGAAGAAGGAGTTTTCA
TCAAATGCAGAGACTAAGGGCAAGATGCCAACTGAGCTACAGACCAAGATTAAAATGACA
TTTGATATTCTCAATAGAATGCAGGAGGGAGAGTTTATGCGGGCTAATCAGAATGAGTCT
GGCAAGGCCGGCAGGAAGAAATCTGATGGAAATGATAGTGATGACGAATATTGA


>Contig10776.0.g25(protein)
MDSRGFKSQYNNGRPGGNGSQSRSKSKPSKDSSKVPSKFVSRKDLRKQAKQDKKQKHADY
FHSRSKSAKDEYQQQQVREKQQEIQKQKQAQQEKLRIEQQSKKIQQLQQEQRDIKMGGKK
PVKREEVNDKVLGKRFKEDVPAKQVSEKRQKVDKNISNDRQEFLKQNEVERQKLDMELKY
LEKKLGIKDDKKRKKINKAIEVEGFGDGFMDFLDGIEGKLKVDTKKYEPKEYVFSDGEGP
EEGDLENLAGQGGAEESDQEGFDEFMSEEEDENDELDEFDDEDEEEEQEEEEDEEEDDGE
DSQGAVDQDNDDEDEEIDSEIYGNEDGDEDLQNGSDVQEDDEDMNDNESNEDQDDFEDDD
DEEDDDENEDEEQIIPKKQQKNPALEKLIRSVLNKVSEGNLEIMFNQLLTETKPYFKNPL
QYAYCYSKLFIQMNIQSKQQMTSILSVNCAFISALHRILGDQFFATAVRQMFIEFQNSHN
ISLGKQPIVGPAIAKIDSDMSDAAKDRVKNLLNCFLHFFIFQSLSSSLLIDLIRLLMNSF
EESDIEVLIFLLHNIGLQLRKSDPEAIRDIIQMSEQKKNSFAVELKMIPQEDPSYDQMKK
KERKIGFLNMELQDIKNNKGTMTLQVKSIEHLQTWIRKNAKLQSELEFQPVDMRAETISN
TLQDDQVLMKKWWLPLSQQKNGQDLQGDFQKPKDFKAESKKTNDILELASKQRMNTDIKK
AVFQAIAGAEDYIQAFENCIRLNLKKQQEREIVKVLMHCCINEKGTFNKFYALLAQRLIK
YQPQSFKYSLKYTLWDYLKTISKFDIRQIANMARIIGFLIGEGDVPLNFLKVINFDQEGL
SQPMHLFLFVLFDSIYDSYSKDQIKSLFKRGISEKHSEFRKGISEYLLTKFYLKKKKEFS
SNAETKGKMPTELQTKIKMTFDILNRMQEGEFMRANQNESGKAGRKKSDGNDSDDEY