Identifiers and Description

Gene Model Identifier

Contig14400.0.2.g71

Standard Name

NOL9b

Aliases

Contig14400_0_2_g71

Description

Molybdopterin guanine dinucleotide synthesis protein B

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( pfam03205 ) Molybdopterin guanine dinucleotide synthesis protein B
  • ( pfam06807 ) Pre-mRNA cleavage complex II protein Clp1

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
SGDYLL035W0.000000005997038937208364GRC3 SGDID:S000003958, Chr XII
from 68580-70478, Genome...
T. thermophilaTTHERM_005900800.000005000363240844623hypothetical protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig14400.0.2.g71(coding)
ATGGAATCTTTAAAGCCATAGAGATCAAGATCTAGAGAGTCTGTAAATTCTGATAGAAAT
CAAGACTTTAAAATATTAGATGCTGATTTACAAACTTGCAAAGTTTTCATTCTCTATAGA
AAGAAGAATTTCTGCTTTTAAGGAGCAACAAAAATTAAAGTGTTATATGGAAGAGTAAAT
ATCTTAGGTGCAACAATAACTCCAGAGCATTGCATAGGGGATAAATGGTTTGATGTGATC
TCAGATCCAAGAAAAAACATGCTCCTTAGCTTATACAACTAAAGCAAAACAGAAGAATTG
GAAGGTTTACAGTTAAGTCTTGAAGGAGAAAGTGAAGAAATCAAGATTGATTATGTTCCG
GAGAGGGCCTCAATTATAGCGATTAAGGAGTATAAGGAATATACAGAGAGCGAGCAAAAG
AATCTATTATAAGCTGATATTCAATTCAACATACCAAACATGAACAGAGACTTCGATGAG
AAAAAGAAAGGCTTCTTTGAATTGAATAAATCTTGGAAATAAGGGATAAATAACATAGTA
CAAAACATCAGAAGCTAACCAGACAATCAAAATATAAAGATCTTGGTAAATGGAGTTGTT
AATGTTGGAAAGTCTACTTTTGCAACTTGTTTGATAAATGAGATCCTATCATAAACTAAA
TCGGATGTATTCATTTTAGAAGTTGACCCAGGCTAACCTAATTACACTTTAGCTGGTCAG
TTGAGTCTTTCTAAAGTTGAAAATATGATCCTTACCAATAACGACTTCAATGATATCTAG
ATACTAAAAAGCTACTATTTGAATTCCCCTTAGCCAAATCTGAATGCAGACTATTATAAC
AAGTCAATAGAACTTCTCGACAAAGAATACCAAAATTATGATACTCAAGGGAGATAGAAA
ATTCTCATTGTAAATACTTGTGGTTGGGTTGAAGGCATAGGTGCAGGAATTCAGTTCAAG
ATTACAGACATAATTTAACCATCTCACATAGTAACCGTCATGAGAGCTGATGTTGGCCTA
TAGGGTAACGAGTTCAGTTAAAAATGCAGATAGCAAAGAGAGGGCTAGATAAATTTCATT
GATGTTAAAAGCGACAAATTTAAGGGAGCTATGAATGTCAAAGGTGCTGTGCAGAGAAAC
AAGAAAATTAAGAAGGCTTTAACTCATCAGGATGAAGACAGATACATATTTGTTAACAAA
TCTCAGGATGGATAAGATCTTCCTTTAGTTTTCAATTCAAAATCAATGAAGCATGATGAT
TTCTCTCTTTCAAATGAAGAATTCAATAAACTTAAAAAACAGCCATTCTAAATAATTCAA
TTCAAAGACATTAATCTCTGTTTCATAACTGAGTAACTGGATTAAGTTCAAAATAAGATT
GAGACTTTGAGATTGTTCGAGAATCAACTAGTTGCTGGCATCTAAATCGATAAAGCTCAA
TTTAAAAGTTTAAGAAGTTTTGAGGACGTCAGAGTTACTGAGATTAGATTTACTTATAGA
CAGCTTCCTCCAATTGAGATTAAATTCTACGGTTTGATTAGGGACATCGATTTTGAGGGT
GGAATCAAACTAATCCCTCAAAATGGAATAGATTTGAGTAAGGTGGAATTCAATGCTTTA
TGCTTGTGTCACGACAGTATTTTCAGATTCCCCTCCACATATTTGATTCAAGATCAGTCT
GGTCACATCCAACAAAACTAGCAGGCAAGGAATGAAGAGAGAAAAGTATTCAGAGGAAAC
AATTAAGATTATAGAGGCGGTAGAGGAAGAGGCAACTATTAAAATAGATATAATCAGTGA


>Contig14400.0.2.g71(protein)
MESLKPQRSRSRESVNSDRNQDFKILDADLQTCKVFILYRKKNFCFQGATKIKVLYGRVN
ILGATITPEHCIGDKWFDVISDPRKNMLLSLYNQSKTEELEGLQLSLEGESEEIKIDYVP
ERASIIAIKEYKEYTESEQKNLLQADIQFNIPNMNRDFDEKKKGFFELNKSWKQGINNIV
QNIRSQPDNQNIKILVNGVVNVGKSTFATCLINEILSQTKSDVFILEVDPGQPNYTLAGQ
LSLSKVENMILTNNDFNDIQILKSYYLNSPQPNLNADYYNKSIELLDKEYQNYDTQGRQK
ILIVNTCGWVEGIGAGIQFKITDIIQPSHIVTVMRADVGLQGNEFSQKCRQQREGQINFI
DVKSDKFKGAMNVKGAVQRNKKIKKALTHQDEDRYIFVNKSQDGQDLPLVFNSKSMKHDD
FSLSNEEFNKLKKQPFQIIQFKDINLCFITEQLDQVQNKIETLRLFENQLVAGIQIDKAQ
FKSLRSFEDVRVTEIRFTYRQLPPIEIKFYGLIRDIDFEGGIKLIPQNGIDLSKVEFNAL
CLCHDSIFRFPSTYLIQDQSGHIQQNQQARNEERKVFRGNNQDYRGGRGRGNYQNRYNQ