Identifiers and Description

Gene Model Identifier

Contig14748.0.g8

Standard Name

NOL9a

Aliases

Contig14748_0_g8

Description

Molybdopterin guanine dinucleotide synthesis protein B

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
SGDYLL035W0.000000000007996637300921877GRC3 SGDID:S000003958, Chr XII
from 68580-70478, Genome...
T. thermophilaTTHERM_005900800.0000007001298633766835hypothetical protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig14748.0.g8(coding)
ATGGATAGAAAGTCAAAAGCAAAAGCTTCTGAGATTGAGCGATCAAGATCAAGAGATAAA
TAAAATGCTCTAACATAAAACAACAGGGATACTTAACCAAAGTAAGAAAAGCATCACGCA
AAAGAAGCAGAGGAAGAGAATGATTTTATAGATGAGTCAAATTAAGATATAAAAATTTTC
AACATAGAGAATTGTGAATCAGCAAAAGTTATTATTTTGTCAGAATCATAATGCCTGAAA
TTTCAGGGAGCTGCTAAATTGAGAGTGTTACATGGTATCGTAAATATTTTTGGAGCTCTT
CTAACTCCAGAAAACACACAAAACTGGGTTGAAATTATTTCTGATCCAAGAAAAGGAATG
CAATTGAAAGCTATAAACTAAACTTAAAGCAAATAATTGATAAATCAAAAATTTGATGTT
GATAGCCATGAAGTAAAAATAAAAGTAATTTAATAAAACTATGCAGTAGTAGCTTTGAAA
GAGTTCACATAATATTCTTAAGAGGAGTCTTAATACTTTTTAGAATCTGATGATCAGTTA
ATGTTGCAAAACTTTACAATTTAGGAAGATCCAGTAAAAGGTTATTTCAACTTTAATAAA
TCCTATGCCACGAGCTTGAGCAAAATTAAAGAGCTTTCTTCGAATAAATCAATCATTATT
TTGATAAACGGAGTTTAAAATTCTGGAAAATCTACCTTCATTTCATGTCTGGCAAACTAA
TTCTAATCACTAAGAAATCATGAAGTCTACCTTCTGGATGCAGATCCTGGACAACCAAAC
TTTACTCTTGCAGGATAAGTATCATTATCCAAAATAAATGATTTGATTTTGACAAATCAA
GATTTCACAAGAGTTGAGAAGTTGAAGAGTATTTTCATAAATAATTCATCACCTCAAATG
AATATAAACTATTATGTGAATGCTGTAGCAGATCTAATGGAGGTATATCATAACTAACCT
CAGATCTCAAAAATTAAAAATAGAGTCTTGTTGGTCAATACTTGTGGCTGGGTAGAAGGT
TTAGGCTCTATGATTCAAATGCAATCTGTCAAAGAAATTAGACCCAATATAGTTGTAACT
ATGTAAAAGCAAGGACAAGGATTGAAAGATAATGATTTCTCTGGAGAAATGAGGACAGTT
TATGATTCTGTTTTATACTTAGACATCGATAATGATATTTTTGAGGGTCAGCAAAACTCA
AAAGGGTCTGTTTAAAGAAATAGAAAGTTAATTAATAGCTTAACTGAGCTCAAAGAAGAT
AGGTACTTGTTTAAGCAAAACTTGATTGATAACTAAACTAAACAAGCAGTTTCATCAATT
GATAATTAAATAAAATGCAGCGATTTGATAATATCAAAAACTTAATCTTTCAGACTAAGT
TCAAGAAAATCATAAGAAGTGTCTTTTGCTAAAATTTCATTTATACTAGGTGATGAATTT
TCCGACTATGAGAGCAAAATATAAGTTCTAAGGCAATTTAATGGTCAAGTTGCTGCTTTT
ATAAAACTTAATGAAACTTCCTTAAAAGATTGCTAAAAGTTATTCAACGATGTCAAAATT
TCTAAGATTGATATGAGAAGCAAAACTTTGCCAGCAATTGAATTGAAGTTTTATGGCTTA
ATCAAGGATGTCGATTTTACCTCAGGATTACATGTTATACCTTAGAATAACTAGCTTGAT
ATTTCATAAGTGTACTACAACGCGATAATGATAGTGGATGAGCATGTTTTTAGAATTTCA
TAATCAAGCATAGTCTAAGAAGACTTCTAGGAAGTTATTATTTAATAGGAGGTCACTAAG
CAAGTGTCTGGAATATTTGAAAATAACCCAATCTATGAATTACAGTATTTCCAAGCAGAT
CTCATGCCTATTATCAAAGAATGA


>Contig14748.0.g8(protein)
MDRKSKAKASEIERSRSRDKQNALTQNNRDTQPKQEKHHAKEAEEENDFIDESNQDIKIF
NIENCESAKVIILSESQCLKFQGAAKLRVLHGIVNIFGALLTPENTQNWVEIISDPRKGM
QLKAINQTQSKQLINQKFDVDSHEVKIKVIQQNYAVVALKEFTQYSQEESQYFLESDDQL
MLQNFTIQEDPVKGYFNFNKSYATSLSKIKELSSNKSIIILINGVQNSGKSTFISCLANQ
FQSLRNHEVYLLDADPGQPNFTLAGQVSLSKINDLILTNQDFTRVEKLKSIFINNSSPQM
NINYYVNAVADLMEVYHNQPQISKIKNRVLLVNTCGWVEGLGSMIQMQSVKEIRPNIVVT
MQKQGQGLKDNDFSGEMRTVYDSVLYLDIDNDIFEGQQNSKGSVQRNRKLINSLTELKED
RYLFKQNLIDNQTKQAVSSIDNQIKCSDLIISKTQSFRLSSRKSQEVSFAKISFILGDEF
SDYESKIQVLRQFNGQVAAFIKLNETSLKDCQKLFNDVKISKIDMRSKTLPAIELKFYGL
IKDVDFTSGLHVIPQNNQLDISQVYYNAIMIVDEHVFRISQSSIVQEDFQEVIIQQEVTK
QVSGIFENNPIYELQYFQADLMPIIKE