Identifiers and Description

Gene Model Identifier

Contig19130.0.g72

Standard Name

NOL10

Aliases

Contig19130_0_g72

Description

NUC153 domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_001606701.999807452113044e-171hypothetical protein
SGDYGR145W9.997751616309157e-110ENP2 SGDID:S000003377, Chr VII
from 781767-783890, Geno...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig19130.0.g72(coding)
ATGAAAGTCTCAGAGCTTAATGGTGTGAAAATGTACGATCTTTCCAGTGGAAAGAGTCTC
CCAGAGTACATGGAGGAAGCCAAAAAGAAAAAGTTGAAGTTGAAGCAACTCGATGAATAT
AGAAATAGAATTGAACTTATACAAGACTTCGAGTTTAACACATCTTGTCAAAAAGTTAAA
GTCACAGAAGACTAGCACTACATTATTGCCACAGGAATTTATGCTCCAATGGTCAAGATA
TACGATACATCAGAATTGTCACTAAAGTGTGAAAGAGGTCTCGACTCAGAAGTAGTTTAA
ATGCAACTTCTCTCAACTGATTACTCAAAAATCGCATTCTTATGTGCAGATAGAAACATC
GAACTACATGCTTAGTATGGCCGTCACTTCAAAATCAGAATTCCCAAGTATGGCAGAGAT
ATGATCTACAATCCATTTAGCTGTGACCTAGTTGCAGTGGGAGCAACAAACGAAATATAT
AGACTTAACTTAGATTTAGGAAGATTCAACACTACTTTGATTAGTGAGTCCCCAGAGATC
AATTGCGTTGATTATAGCAGTGACTTGAATGTGATAGCAACAGGTGGTATTGACGGAAGA
GTAGAATTCTGGAATATGGACAATCGTGCTAAAGTATGCGCTCTTACACCACAAGGTCTA
AATTTTGACGATGAAGAGATAACTGCTCTTAAGTTCGAATAGGGAACCTTGAATATAGCA
GTTGGAACTGCCAAGGGAAAAGTCTTGCTTTATGACATGAGATACCCCTTGCCCCTACTA
TCTTTAAATCATCACTATAGACAGCCAATTCACACAATTAGTTTCCATTAAGCATCTAGG
AAATTGATCACTGCTGACAAAAAAATAATCAAAATCTATGACAAAGATAGCGGCAGATTA
TTTACAAATATTGAGCCAAAAACTGGCGTCAATAGTTTTGAGATGTGTGCTGATAGTGGA
CTTATGTTTGTACCATAGGAATAAAAGAAAATTGGAACTTACTTCATTCCTAGTTTAGGT
AATGCACCCAAGTGGTCAGCATTCTTGGAAAATTTAACAGAAGAAATGGAAGAATCAAAG
AGTTCATCTATGTATGAAGACTATAAATTCCTTACAATGACTGAACTCTAATAACTAAAT
GCCACTCATTTAATTGGTACTCCAATGCTAAAAGCGCATATGCATGGTTTCTTCATTGAA
ATGAAGGCATACCAGAAGCTTCTTAGTGTTGCAGATCCATTTGCCTATGATAGATATAGA
AAAGAACTCATCAATTAGAAATTGAATTCTATGAGAGAAAAACGTATATTATTACCAGGA
TAGAAAAAAGCTACTGTAAACACAGAGTTTGCAGATGAATTGATAAGTAAATAAGAAAAA
GGTGGTAAGAAGTCTTCTGGTAAAGACGCTGAAAAATTGATGAGTGACAACAGATTTAGC
AAGATGTTCGAGGACACAGATTTCAAGATTGACAGAACCTCAGAAGCATACAAGCTCATT
AAGCCTCAAGAGTCCAAGAAAGGAAAACTTGACGATATTGATTCTATAAATGGGGATGAC
TCTGAAGATGACGAGTAGGAGGGTAATGTGAGAAAGGGACAAGGTCTTAATAAGTTGTTC
AGTGGGTAAGTCGAGAGCGAGGATGAAGGCAATGGCGAAGGGGACGATGATTTTATGTCA
AAGATGGATAAGAAGTAAAAAAAGAAGTACAAGAAGTCAAATCAGGATAAGATTTTAATT
GGTAAAGGAGCAATAAGAAACTTAAACATGCCTCAAAAGAGCGATTAATCAAAGAAAATA
AAAAAGCATCAACATAAGGGAAAGCACGTAATAACAGATTAGCAAGTAAAAGAAAAACTT
AAGTCTAGAAGAATGGTTGTTTCTACAAATAGGCTTAAGTGA


>Contig19130.0.g72(protein)
MKVSELNGVKMYDLSSGKSLPEYMEEAKKKKLKLKQLDEYRNRIELIQDFEFNTSCQKVK
VTEDQHYIIATGIYAPMVKIYDTSELSLKCERGLDSEVVQMQLLSTDYSKIAFLCADRNI
ELHAQYGRHFKIRIPKYGRDMIYNPFSCDLVAVGATNEIYRLNLDLGRFNTTLISESPEI
NCVDYSSDLNVIATGGIDGRVEFWNMDNRAKVCALTPQGLNFDDEEITALKFEQGTLNIA
VGTAKGKVLLYDMRYPLPLLSLNHHYRQPIHTISFHQASRKLITADKKIIKIYDKDSGRL
FTNIEPKTGVNSFEMCADSGLMFVPQEQKKIGTYFIPSLGNAPKWSAFLENLTEEMEESK
SSSMYEDYKFLTMTELQQLNATHLIGTPMLKAHMHGFFIEMKAYQKLLSVADPFAYDRYR
KELINQKLNSMREKRILLPGQKKATVNTEFADELISKQEKGGKKSSGKDAEKLMSDNRFS
KMFEDTDFKIDRTSEAYKLIKPQESKKGKLDDIDSINGDDSEDDEQEGNVRKGQGLNKLF
SGQVESEDEGNGEGDDDFMSKMDKKQKKKYKKSNQDKILIGKGAIRNLNMPQKSDQSKKI
KKHQHKGKHVITDQQVKEKLKSRRMVVSTNRLK