Identifiers and Description

Gene Model Identifier

Contig10756.0.g111

Standard Name

NOG1

Aliases

Contig10756_0_g111

Description

Nucleolar GTP-binding protein 1 (NOG1)

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_002425009.997093137033517e-262hypothetical protein
SGDYPL093W2.0004882463825047e-175NOG1 SGDID:S000006014, Chr XVI
from 370978-372921, Geno...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig10756.0.g111(coding)
ATGAGTTCTTCCTATAACTTTAAACAAATCCAAAAGATTCCCGATGCCAATGAGTTGATC
GACATCACTCTATCAAAGACACAGCGCAAGACCCCTACTGAGATCCACGCTAACTTCAAA
ATATCTCGTATTAGAAAATTCTACATGAGAAAGATCAAGTATATGCAGGAGGCCGTCTGT
GAAAAATTAACAGGCATCGTTGAAGGATTCCCAAAGCTCAACGATATTCATCCATTCTAC
GCAGATTTAATGAATATTCTTTATGATAAGGACCATTACAAGTTGGCCTTAGGTCATGTT
AACAAGGCAAAATCCATTGTTGATAATGTTGCAAATGATTATGTTAGGTTGTTAAAGTAT
GCCGATAGTTTATATAGAGCTAAGCAGTTAAAGAGAGCTGCCCTCGGTCGTATGTGTACT
TTGATGAAGAAGCTTAAGTCTTCTCTAAGCTATTTAGAGGAGGTCAGAAAGCATTTGGCC
AGATTACCATAAATCGATCCCAACCAAAGAACTCTTATCGTGACTGGTTATCCAAATGTC
GGAAAATCTAGTTTCATGAATAATGTCACTGATGCTAACGTAGATGTACAACCATACGCT
TTCACCACTCAATCACTATATGTTGGTCACACTGACTATAAGTATGCTAGATGGTAAGTA
ATCGATACTCCAGGTATCCTAGATCACCCCCTTGATGAGAGAAACACAATTGAAATGCAA
TCAATTACTGCACTAGCTCATTTGAACGCCTGTATTCTCTACTTTATTGATATATCAGAA
ACTTGTGGATATACCATTGAACAATAAATTTCTCTATTCAAGAACATTAAGCCACTTTTC
CAATCAAAGCCCTTAGTGATTGTTTTGACTAAAATTGATTTGGTTAAGTATGCTGAGCTT
GCAAAGGATATTAAAGCCCTCATTGAAAATCTTGCCAAGGAGCACAACGCTTATTTGATT
CAAATGTCAAATCAGAGCGGAGATGGTATCACAGATGTTAAACAAAAGTCATGCGATATT
TTATTGGATTACAGACTAACCCAAAAGGCAAAGGATCCAAAGAAAGCTGAGGCTTTGATG
AACAGACTTCACTTAACTCAACCAAAGAAGAGAGACAACGTTGACAGACCATCAATCATC
CCAGACACTGTTAAGCAAGGATTGAAGAAACAAGGACCAACCATTAAGGATTTGCAAGAA
GAATTTGGAGGTGCAGGTAATTTCTATATTCCAGTTGAGGAGCACTATCAACTTGAGAAC
GACGACTGGAAATTCGATAGATGGCCCGAGTTCTATCTTGGTAAAAACGTCATGGATTTC
TATGATCCAGACATCGAAGAAAAGCTAAAAGCTCTCGAAGATGAGGAAGACAAACTTCTC
AAGATTGAATCCCAAGAAAATGCTTTGATGGAAGACGACGATGCTGAAAACTCAGACGGA
GTGACTTATGACGAATTAAAGAAAGCTCTTAAGGAAGTAAGAGGCAAGAAGTCTGTTATT
AAGCTTTAACACAAATTAAAGAAAAATCTAAGAGCAAGATCCAAGAACAAGAAGCTTAGC
GATATGGAAGAGCACTTAGAGAAGAAGGGCATCAAGGCTAACTTAGAGTCACTTAGATCA
AGAGTTAAAGGAGGAAGAAAATCCATTGGAGATCTAGAAGGCAATCAAGACAGATTAGCA
TCAAAAGCATTAGATGATGAAAGTGGAAGTGAAATGGAGGATGTTGATGATGTCAGAGTT
GGTCGTAAGAGAAAGCGATCCATGTCTGATAGCTCAGATCAATACGATGCTCTTTCAGGT
AGAAATAAATCAATTAACCCATCTACTGGAAAGAAACGTAGATCCCTTACTCCAGCTCAA
CTTAAGATTACTGCTCAATCTAAAGTAAGATCTATGTCTAAGGGTAGAAGAGAGGGATCT
GTACCCCAACCCCATCCAACTAGAGTCGTACCAGAGGAACAAATCAGACTTGCTAAGAAA
ATTAACAAGAAAGTGTTCAAGCATGCTCTTGCTATTAACGAAGCAGATAGACACGTACCC
ATTAAAATGCCTAAGCATTTGTATACTGGAAAGAGAAGCAATGGTAAAACCGATAGAAGA
TGA


>Contig10756.0.g111(protein)
MSSSYNFKQIQKIPDANELIDITLSKTQRKTPTEIHANFKISRIRKFYMRKIKYMQEAVC
EKLTGIVEGFPKLNDIHPFYADLMNILYDKDHYKLALGHVNKAKSIVDNVANDYVRLLKY
ADSLYRAKQLKRAALGRMCTLMKKLKSSLSYLEEVRKHLARLPQIDPNQRTLIVTGYPNV
GKSSFMNNVTDANVDVQPYAFTTQSLYVGHTDYKYARWQVIDTPGILDHPLDERNTIEMQ
SITALAHLNACILYFIDISETCGYTIEQQISLFKNIKPLFQSKPLVIVLTKIDLVKYAEL
AKDIKALIENLAKEHNAYLIQMSNQSGDGITDVKQKSCDILLDYRLTQKAKDPKKAEALM
NRLHLTQPKKRDNVDRPSIIPDTVKQGLKKQGPTIKDLQEEFGGAGNFYIPVEEHYQLEN
DDWKFDRWPEFYLGKNVMDFYDPDIEEKLKALEDEEDKLLKIESQENALMEDDDAENSDG
VTYDELKKALKEVRGKKSVIKLQHKLKKNLRARSKNKKLSDMEEHLEKKGIKANLESLRS
RVKGGRKSIGDLEGNQDRLASKALDDESGSEMEDVDDVRVGRKRKRSMSDSSDQYDALSG
RNKSINPSTGKKRRSLTPAQLKITAQSKVRSMSKGRREGSVPQPHPTRVVPEEQIRLAKK
INKKVFKHALAINEADRHVPIKMPKHLYTGKRSNGKTDRR