Identifiers and Description

Gene Model Identifier

Contig11478.0.g72

Standard Name

NOC4L

Aliases

Contig11478_0_g72

Description

CBF/Mak21 family

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
SGDYPR144C8.002251789887453e-32NOC4 SGDID:S000006348, Chr XVI
from 821423-819765, Geno...
T. thermophilaTTHERM_004628303.0007793728221555e-22hypothetical protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig11478.0.g72(coding)
ATGGACTTGTTTAGTTAAATTTTGATTAAGCTTTAAGAATAAGAAGTGATAACTGATCAA
GAAGTTAAGATCATAGTTTTCAATCAAGAAGCTAGTCATTTAGTGGAGACTCATTAATTT
GTTGTATAGCGCATGAAGGTATTCCTAGAAAATGTCATTAGTTAAGCCACAGAAGTAAAT
CATTACAGAGAAGCTAGCAGAGTACTGATCGAGCTTACACAGAAAATAGTGCAGGCTATT
AAGATAGAAGATTAAAATAATTTAGATGAGAATGAAATTAAAATGAAAGTCACAACTTAA
TAGGTTGAGTTGCTTGCTGGAGAGAAAGGGTTTTTCTCATAAATCATGAAAAAAGGATTG
ATTAATAAGGGAGAGATCTATGATAATTAAAAGATTCTAGTTGAAAACTATTTGGATTAA
CTCTATAAAATACTGAAGGACTTCCCTATGTTTGAGAAGGAAGAGGAGCCTATGTAAATT
ATCTTGCTTAATTAGGAGGACGATGACGAAGATTTAGTAGGTGAAAGTGATGAAGAAGAG
GTAGAAAAGAAAAGTAAGCAAGCTTCTCCTTAAAGCATTGGACAGAGAGCCAAAGTTCTT
GAATAAGCAAAAACAATGTTTCAGAAATGCTACCTCGAAATGCTTAACAGATTAAAGAGC
AGTGAAATTATCAGAGAGATATTGAATGATCTAAATAGAATGGTTATACCAAACTTCTAA
AATCCTATATTCTTGAGTGACTTCCTTTCCTATTATTTGGATTAAAACGAACAAGTTGAA
ATTTAAGTTCTAGCCTTAAAAGCTATTTTCATATTACTTGAGAAGCATGGACTTGATTAT
CCCCAATATTACAAGAAATTGTACAATATGATTAAACCTCAACTAATCTACGATGAGAAG
CTAGAATCAGTTTAAATGCGTTCAATTTTCCAAATTTCAGATAAATCTAGATTCTTGCGT
CTCCTTGATTTGTCTCTCCGTTCTCCATCCCTTCCAACCAAAATGATCGCAGCATTTTTG
AAAAGGCTTTCTAGAATTGTGGTGAGCTATGGTTCATGCTTCTCTAGTTAAGATTTAATG
TTCACAATCTCCTTCATAGCCAATATGTTGAGGAGACACCCTAGATGCTACAAATTAGTT
TCTAGGAAGAAACTTGATAAAAAGCAAATAAGAAGCATTAAAAACGATCCATACCGTGAA
GACGAGGCTGATCCTATGGAATCCAGAGCTTTACATTCCTGTCTATGGGAGATTGAAATC
CTCATGAAATAGCACTTTGATTCAAAAGTCAGAGACTTTGCAAAGATTTTCAAGACTGAT
TTACATAAAAAGACTTCCTACTTCAAAAGTGAGGAATTTACTGTTGCCGATCCCTTAGAG
TTGCTTGTCTTAGATCTTAATGAAGTTGATGAGAAGAAAGAAGGAAAAGCCTTCAAGAAA
AACCTTTTGGTCAAACATGGATAAAGCAGTGCTCAATTAGGACTTATAGGATAGAAGAGA
ACTTAAGACATGGTTGAAGATTATTAGGGATATGGTTATAGAGACTAGACTGAGGGCTAC
AAGAGATACAAATATGGTGAAGAATTTGAGGATGTTCATGATATACTCAGTCTTCATCAC
TGA


>Contig11478.0.g72(protein)
MDLFSQILIKLQEQEVITDQEVKIIVFNQEASHLVETHQFVVQRMKVFLENVISQATEVN
HYREASRVLIELTQKIVQAIKIEDQNNLDENEIKMKVTTQQVELLAGEKGFFSQIMKKGL
INKGEIYDNQKILVENYLDQLYKILKDFPMFEKEEEPMQIILLNQEDDDEDLVGESDEEE
VEKKSKQASPQSIGQRAKVLEQAKTMFQKCYLEMLNRLKSSEIIREILNDLNRMVIPNFQ
NPIFLSDFLSYYLDQNEQVEIQVLALKAIFILLEKHGLDYPQYYKKLYNMIKPQLIYDEK
LESVQMRSIFQISDKSRFLRLLDLSLRSPSLPTKMIAAFLKRLSRIVVSYGSCFSSQDLM
FTISFIANMLRRHPRCYKLVSRKKLDKKQIRSIKNDPYREDEADPMESRALHSCLWEIEI
LMKQHFDSKVRDFAKIFKTDLHKKTSYFKSEEFTVADPLELLVLDLNEVDEKKEGKAFKK
NLLVKHGQSSAQLGLIGQKRTQDMVEDYQGYGYRDQTEGYKRYKYGEEFEDVHDILSLHH