Identifiers and Description

Gene Model Identifier

Contig13994.0.g7

Standard Name

NOC3

Aliases

Contig13994_0_g7

Description

CBF/Mak21 family

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Biological Process

Domains

  • ( pfam03914 ) CBF/Mak21 family
  • ( pfam07540 ) Nucleolar complex-associated protein
  • ( pfam06103 ) Bacterial protein of unknown function (DUF948)
  • ( pfam01620 ) Ribonuclease (pollen allergen)

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_001918501.0004572433669413e-23hypothetical protein
SGDYLR002C2.000620012690291e-23NOC3 SGDID:S000003992, Chr XII
from 156334-154343, Geno...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig13994.0.g7(coding)
ATGGATAGCATAAACATTTCCCAGCAGGACTTCGACAAAAAGCGTAAATCTAAGGAGGAG
CGCCGTCGCCAAGTCAAAGAGACTAGAAAAAACAAGTTGAAGGAGCATGCCAACCAGAAG
CAAGTCAACCCTCAGAAGTCATTCGAGAAGCATCTCGAGAAAAAGAAAACTGAAGAAAAT
AAGGAGCAGCTTACTAAGGAACTCATGAAAGAGATGAACATCGCTTAAAAGTTATCATAT
ATCAAAGCCACATCGAACGAAATAGTTTAAGACGTTGAAGAAAAATACAGAAAAATAAAT
GACTTATTGATGCTATGCAGTGACGCTAAAGATATCGATGTTGTATTAAAAAGTATACAG
GCTCTATGTGAAGTATTCTGTGATATACTTCCTACCTATAGAATCAGAGAATAGAAGACT
GATGTTGCTGAAGATTTTGGCAAGGCAAAACCCAACAAAGGAGAGGAAAATGAAGGTGGT
GAAGCCAAAGGGAAGGACAAGAAAGATAAAAAGAGTTAGAAAGTCTCAAAAGAAGTCAAA
GTTATGAGAGAGTACGAGCAATCATTGCTTCAATCATACAGGGAATACTTGAAAATTTTA
GAAGTATTTTCAAAGACAAAAACAGAGAAAATCATAAAGAAGCAAGGCATCCAAAAAGAT
GATGCAATCAGAAGAAAGAAAGCGATAGAAGTTTATAGAAAACTTAGAGAGATTAGTTTC
TTATCTTTCTGCTCATTGTTAAGCAGACATCCTCATTTCAACTACAGATTGAACATTCTT
TAAATTGTGATGCCAAAAATATCCACCAATGATCTTGCAATTAGAAAGATTGTCACTAGC
ACAATTTTCGAATTGATTAGTAAAGACGACAACACCCTTTTAGACTTTAAACTTGAAATA
TTGAAGGAATTGTCAAAGGTTTTAAAGCAGATCCCAAATCACAATAGAATTGATGCCAAT
CTCCTAGATTGCTTGGTGACTCACAAGATTATTATTGATGAAGCTAAGGCAAAGGTAATT
GACGAGAATACTAGGAAATTAACTTAATTAAAGCAATAAATGGATAAATTGAGAAAGAAG
GGTAAGTTCAATGAATATAAAGATCTTAAGATGGAATTATTGAAAGAAATGAAGGAAACC
GATGCATTAGGTATTGATCTTGGATCTACCTCAAAGATAAACAATGCAATAATTAAAGAG
ATTCTTGGCATTTACTTTGGAGTTTTGAAGGATAAGAATGACTCTCCCCTTTTGAAAGGA
GTGTTTTTAGGACTCCCTCAATTTACTTAATATGTAAACATTGAAATTGTATGGGACTTG
ATCAATGTCTTAAGAGAGTATCTGAATATGGAACTTTCTGACTGGGAAAATGGAACAGGA
ACATCAAGAAGATAAAACATCTCAAATGTGCTTACTGGTCTACTTTGCTCTTTCCAAATC
ATCGAAGTTGGTGCTGGTACCGCATTTAACGTTGAAGAGAAAGATTTCCTGAACACTCTG
TATGCAGTTATTCAAAGAATGTTTGAACATCCATTTAACTATTAAACTTCAGACTTTTTA
GCGTTCTTGAAATGCATGAATATAGTGTTCATAAAGAGAAGATAGTACTCTAATGAACTT
GTACATGCCTTCGTAAAAAGATTAGCCTTGTTTTAAATGCAGATTACTGATGCTGAGCAA
GTTTCAATTCTATACTTGATGAAATAACTCATAACCAAGTATCCCTCTTCTAAATCTTGT
CTTCTTGAGCTCGACGATGATGGAATCAATAATGCATTTATGGCTTATGAAAACATATAC
AAACCAGATATAAGCGATCCTTAACTTGCCAACTCATCATAGTCTTCAATTATATTGGAA
TTAACAAGCACTTCAAATCTATATAAAGGCACTAAGAATCCTTTAGAGTCATATTGTTAT
AGATTAGCAAAGGGAATGCTTCTTAATGAAGCTTTACCTTAAGAGTTCTTGGGTATGACT
GCACTTGATGTTATGAGGAAAATATCAAAAGAAAGCAGAATTCAATGA


>Contig13994.0.g7(protein)
MDSINISQQDFDKKRKSKEERRRQVKETRKNKLKEHANQKQVNPQKSFEKHLEKKKTEEN
KEQLTKELMKEMNIAQKLSYIKATSNEIVQDVEEKYRKINDLLMLCSDAKDIDVVLKSIQ
ALCEVFCDILPTYRIREQKTDVAEDFGKAKPNKGEENEGGEAKGKDKKDKKSQKVSKEVK
VMREYEQSLLQSYREYLKILEVFSKTKTEKIIKKQGIQKDDAIRRKKAIEVYRKLREISF
LSFCSLLSRHPHFNYRLNILQIVMPKISTNDLAIRKIVTSTIFELISKDDNTLLDFKLEI
LKELSKVLKQIPNHNRIDANLLDCLVTHKIIIDEAKAKVIDENTRKLTQLKQQMDKLRKK
GKFNEYKDLKMELLKEMKETDALGIDLGSTSKINNAIIKEILGIYFGVLKDKNDSPLLKG
VFLGLPQFTQYVNIEIVWDLINVLREYLNMELSDWENGTGTSRRQNISNVLTGLLCSFQI
IEVGAGTAFNVEEKDFLNTLYAVIQRMFEHPFNYQTSDFLAFLKCMNIVFIKRRQYSNEL
VHAFVKRLALFQMQITDAEQVSILYLMKQLITKYPSSKSCLLELDDDGINNAFMAYENIY
KPDISDPQLANSSQSSIILELTSTSNLYKGTKNPLESYCYRLAKGMLLNEALPQEFLGMT
ALDVMRKISKESRIQ