Identifiers and Description

Gene Model Identifier

Contig9986.0.1.g80

Standard Name

NOC2La

Aliases

Contig9986_0_1_g80

Description

Domain of unknown function (DUF367)

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( pfam04034 ) Domain of unknown function (DUF367)

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_001607109.999888128184441e-42hypothetical protein
SGDYOR006C2.0006622580855403e-35TSR3 SGDID:S000005532, Chr XV
from 338621-337680, Genom...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig9986.0.1.g80(coding)
ATGATTTTGAAGAAACATGGGTATTTAAGCACTTTGAGCAAATCGGCTAAGTTTAATGGT
ATTGTTCTTACACCTACTGCCAGCAAAGTCATTTCACCTGAAGATAGGGAAATTGTTGAA
ACCAGTGGTCTATGTGTGATAGACTGCTCATGGCAGTTTTTTGATTCTGTAAAAGTGAAG
TCAATTAAGAAAAATGAGCGTTTACTACCATACATGCTTGCATCTAACCCAGTGAATTAT
GGCAAAGAAATCAAACTTAACTGTGCTGAGGCAATGGCTGCTGCCCTATTTCTGTCTGGA
TTTTAAGATGAAGCTGAGGAGGTGATGAGCGTGTTCAAGTGGGGTGGAGCTTTTTTCTTC
CTGAATGAAATATACTTTGACAAATATGTTCGTGCTAACACCTCAGATGAGATGATGAAA
GCGGAGGAAGAGATGATGATTGAATTGGAGAAACTTCGTGAAGAGACCAGACAGCAGAGG
AATGACTTTGATATGCTTCCCAGTTCATCAGATGAAGACGAGGAAGAACAAGTTGATCAA
AATAATGATGACAAAGAACAGGAAGAAGAAGTAAAGAAAGAAGAAGAAGATAGCAAGTAA
CTCGTTGTTAATCAGGACGAGGAAGAAAAGAAGGGTAAAGAAGAAGAAGAGAATAAAAAA
GACGATTAAGATGAAGAATTGGATGAAATGGAAAAGATGAGGAGAAACAGAATCAAGAAA
TGGGAGTTAAGCAAACTTGAATCGAAGTAAGAAAAGTTAAAGAAGAACAAACATGCTTAA
GAAGATGATGATGAAGAAGACAGTGATGAAGATGAAGAGGAAGTGAAGGATGATAACAAC
GATGTTGAGGAAAATAAATCAGATGATGAAGATGGTAGTGGCGATGATGATAGTGATGAA
GACACTAGATAGAAGCGTCTGAAGGATCTCAAGTAAAAAATGAAGAAAATGAAAGTAAAA
CCAGCCAAGAAATCCAAAAATTAGGAAGACAGCAATTGA


>Contig9986.0.1.g80(protein)
MILKKHGYLSTLSKSAKFNGIVLTPTASKVISPEDREIVETSGLCVIDCSWQFFDSVKVK
SIKKNERLLPYMLASNPVNYGKEIKLNCAEAMAAALFLSGFQDEAEEVMSVFKWGGAFFF
LNEIYFDKYVRANTSDEMMKAEEEMMIELEKLREETRQQRNDFDMLPSSSDEDEEEQVDQ
NNDDKEQEEEVKKEEEDSKQLVVNQDEEEKKGKEEEENKKDDQDEELDEMEKMRRNRIKK
WELSKLESKQEKLKKNKHAQEDDDEEDSDEDEEEVKDDNNDVEENKSDDEDGSGDDDSDE
DTRQKRLKDLKQKMKKMKVKPAKKSKNQEDSN