Identifiers and Description

Gene Model Identifier

Contig9370.0.0.g15

Standard Name

NOB1

Aliases

Contig9370_0_0_g15

Description

Nin one binding (NOB1) Zn-ribbon like

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_002471003.00033207980219e-32hypothetical protein
SGDYOR056C2.000769134519826e-18NOB1 SGDID:S000005582, Chr XV
from 431626-430247, Genom...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig9370.0.0.g15(coding)
ATGCATGGTGATAGACAGGCACTAGGGGATTCTGATAGAGGGGAACTGGGTAGAATTGAA
GATGATGAGGATTTCAACGATAAATACGAGGTACACACTCTCATTGATGTCATTAAGGAA
ATACGCGATGAGCAAACCAGAATATACTTGCAGAACTTACCATATGAATTGATTGTGCAT
GGAGAGGAATACGTAGATGCCAGTAATATGATATTAGTGAGTAACTTCGCCAAGGACACT
GGTGACTTCAAGACTTTGTCCAAGGTTGATATGAGAGTCATTGCTCTAGGAGTCTAATTG
GCCAGAGAAAAGGGAGAATTCGAGAAATTGAAGCAAGAGCCTAAGCCACTCCAGGAATTC
AGACCCAAGAAGTTCCAATAAGACTATGAAAGACTAGAAGAAGAGGATGAATACGACAGT
GAAGAAGAAGAAAGTGAAAGCAAGAAGAAGCAGTAACAAACACCAGCTGATGATGGTTTC
CAGCAAGTAAAGTAGGGCAAGCATGGCAGCAGAAAGAATCATGTCAAGCCTAAGCCAGCA
TAAAAGCAAGAAGATGATGTGGAAAACGGAAATAAAGTTGATGGAGAAGTTAAAGTTAAT
GCATAAGTTGATGTTAATAAGACTGAAGAGGAGTAAGTACTGTAGAAAGAAGAGCAGGAT
GACAATGATGTGCCAAGTGACCTAGATGACGAGGAAGAAGGTGGACAGTGGATCACTCCA
GAGAACATCCACAAACACATTCTAGGTGGTGAAACTGCTCCAATTAAGAAGAAGAATCAA
GAAGATGGTCCTCAGCTTGTGTAAATGATCACCAGTGATTACGCTATGCAAAACGTCATT
ATCCAACTCGGCTTCAAATTACTGTCTCTTGATGGTCGCCGTATCACCAGAGTGAAGAGA
TTCAAACTTTTGTGCAGAGCCTGCCAAAAACTAAACTTAAACGTTGAGAAGATGTTCTGC
GATCACTGCGGCTCTCACACTTTAATTAAGGTATCTGTATACATCAAAGAGGATGGCACT
ATCACATATTTCAAGAATCCAAAACGTAGAGTCAACTTGAAGGGCAAAATTTACTCCATT
CCTAAGCCAGTTGGAGGAAGAAACAACAACGATTTAGTCTTGAGAGAAGACGAGTTAATG
ACTGGGGAGAAAAAGATGCTTGTCAAGAAGATTGAGAAAGAGCACAAGAAGCTTGCTTAG
ACTCTGAGTGATACCATCCAAGGAAACTATTGGGCCGGAGGAGAGGGCTACGGAGCCGGA
GCTGCTGTCAGTAATCTACTTTATGAAAACGGTGCCAAAGGAGGCAGAACTCACTCAAAG
ATGGTTGGTATGACAGACAGTATTGTTATTGGCTATGGAAAGTAAAACCCAAATAAAGTA
AAGAAGAGAACTGGAAACTGA


>Contig9370.0.0.g15(protein)
MHGDRQALGDSDRGELGRIEDDEDFNDKYEVHTLIDVIKEIRDEQTRIYLQNLPYELIVH
GEEYVDASNMILVSNFAKDTGDFKTLSKVDMRVIALGVQLAREKGEFEKLKQEPKPLQEF
RPKKFQQDYERLEEEDEYDSEEEESESKKKQQQTPADDGFQQVKQGKHGSRKNHVKPKPA
QKQEDDVENGNKVDGEVKVNAQVDVNKTEEEQVLQKEEQDDNDVPSDLDDEEEGGQWITP
ENIHKHILGGETAPIKKKNQEDGPQLVQMITSDYAMQNVIIQLGFKLLSLDGRRITRVKR
FKLLCRACQKLNLNVEKMFCDHCGSHTLIKVSVYIKEDGTITYFKNPKRRVNLKGKIYSI
PKPVGGRNNNDLVLREDELMTGEKKMLVKKIEKEHKKLAQTLSDTIQGNYWAGGEGYGAG
AAVSNLLYENGAKGGRTHSKMVGMTDSIVIGYGKQNPNKVKKRTGN