Identifiers and Description

Gene Model Identifier

Contig14252.0.g69

Standard Name

NMD3b

Aliases

Contig14252_0_g69

Description

NMD3 family

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
SGDYHR170W5.00227046936594e-128NMD3 SGDID:S000001213, Chr VII
I from 443828-445384, Gen...
T. thermophilaTTHERM_004705303.001062636953563e-123NMD3 family protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig14252.0.g69(coding)
ATGGAGGCTTAACTAAACCCTAATATTATTTTCGATGCGAATGCAGATGGAGCTTAAAAC
CCTCACGACACCCGTTAATTCCTAGAGGATGAACTCCTAGAGACTTAGAGTGTGAGTACA
ATAGGGGGCCACGAAGAAAAAATAGTAAATAACTACAAGAGAGATTTAGATCCTTCTCTC
TTCTCTGCTCAGAAAATTCGATGCTGTGATTGTGGAGTTATGACGACACCTAACGAGTCA
AACAAGTGTATTAACTGCCTAAAATCCCATATAAACATTACAAATGGCATTCCAAAGCAA
ATAGATCTATTTTCTTGTAAAGAATGTAATAGATATCTACGCCCTCCTTGGGTTAATTGT
GAATTGGAGTCCCCCGAGCTGCTTGCAGTATGTTTGAAGCATATCCATGGTCTCAAGAAA
GTGAAACTAATAGATGCTGGATTTGTGTGGACAGAAGCCCATTCCCGTAGAATCAAAGTT
AAAATCACTATTCAAAAAGAGGTCTTAAACAATACTCTACTCTAACAAAGTTTTGTGGTG
GAATTTGTAATTATAAATAAGCAGTGCGATGAATGCAAGAAAACTTACACGCCACATCTT
TGGAGTTCCATTGTGCAGGTTAGATAAAGAGTTGATCATAAACGTACATTCCTCTTCTTA
GAGCAGTTGATCATTAAGCATAAAGCAGCAGATAGAGCAATTGGAATCAAGGAGGTCCAC
GATGGAATAGATTTCCAATTTAAGAGCAAAGCAGATTCTGCTAAATTGATTGACTTTATC
TCAATGACAGTGCCATGCAAATCCAAGCAGAGTCAGTAGCTTATTAATTCAGATTTGACT
AACAACATCTTTAAGTATAAGTACAGCACATCAATAGACATAGCTCCGATATGTAAGGAT
GACTTGGTTATTATCCCGAAAGCTCTTTCAAATCAGCTTGGTGGAATTGGGCCAATGATA
ATTGTCTATAAGATTAGTACATCTATTCATATTGTTGATGTCTTCACAATGCAAACATAT
GAGCTAGACTAAATAACTTACTGGAAGCATCAATTCCACGCACTGTGTGGCAGAGATAGA
CTAACTGAATTCATAGTTGTAAATATAGAGGAGCCTAATAAAGACTTCAATGTAAGTAGA
GCAGCTGCTAAGCAGAAATTCAAAATGGTATCAGTGGAAGTACAGAGAAAGGAAGACTAT
GGAATAAACGATACCACATTTTCGATTAACACTCACCTTGGAGAGACATTGAATTTCTTT
GACACTGTGCTGGGCTTTGATTTTGAATAGATGAATTTTAGTGAGATTGATGAAGTCAAA
AATATGAAGCGTGGATTACCAAGTGTCGTATTAGTGAAGAAAACTTACCCTAAAGCAAGA
TAGAGAAACTAAAAGAATCGTGTATGGAAGCTTAAGACTCTTGAGAAAGAAACGTTAGAT
GAAAATAATCACCACAAAAAAGAGAAATCTAAGGCAAAGAATCAAAGAGACATTGACTTA
TTCATGCAAGACATAGAGGAAGAGCCTGATCTCAGATAGCAAATCGATTTGTTCAAAGAT
GAAGAAGTCATTGAGCAAATCAAGCAAAAAGAAGCCAAGAAACTAGCTTAGAAGAACAAA
GACGAAGGTCAAGATCCCAAAGAAGAAGAAAAAGAGGATGCTGCTGGTGGTAAGAAGAAA
AAGAAGAAGCAGAGAGAAGAGAAAGAGGAGGATGGTGATGTCAGTGTGGAGGAAGATTTC
CCAGAGATCAAAGTAGATGATCTTAAGACTTATGAGCATCAACTGTAGAACTTGAATATT
CAAGATGAGGAAGACGATGGATTTTGA


>Contig14252.0.g69(protein)
MEAQLNPNIIFDANADGAQNPHDTRQFLEDELLETQSVSTIGGHEEKIVNNYKRDLDPSL
FSAQKIRCCDCGVMTTPNESNKCINCLKSHINITNGIPKQIDLFSCKECNRYLRPPWVNC
ELESPELLAVCLKHIHGLKKVKLIDAGFVWTEAHSRRIKVKITIQKEVLNNTLLQQSFVV
EFVIINKQCDECKKTYTPHLWSSIVQVRQRVDHKRTFLFLEQLIIKHKAADRAIGIKEVH
DGIDFQFKSKADSAKLIDFISMTVPCKSKQSQQLINSDLTNNIFKYKYSTSIDIAPICKD
DLVIIPKALSNQLGGIGPMIIVYKISTSIHIVDVFTMQTYELDQITYWKHQFHALCGRDR
LTEFIVVNIEEPNKDFNVSRAAAKQKFKMVSVEVQRKEDYGINDTTFSINTHLGETLNFF
DTVLGFDFEQMNFSEIDEVKNMKRGLPSVVLVKKTYPKARQRNQKNRVWKLKTLEKETLD
ENNHHKKEKSKAKNQRDIDLFMQDIEEEPDLRQQIDLFKDEEVIEQIKQKEAKKLAQKNK
DEGQDPKEEEKEDAAGGKKKKKKQREEKEEDGDVSVEEDFPEIKVDDLKTYEHQLQNLNI
QDEEDDGF