Identifiers and Description

Gene Model Identifier

Contig20934.0.g47

Standard Name

NMD3a

Aliases

Contig20934_0_g47

Description

NMD3 family

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_004705302.9991470337942304e-139NMD3 family protein
SGDYHR170W4.999822746981985e-134NMD3 SGDID:S000001213, Chr VII
I from 443828-445384, Gen...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig20934.0.g47(coding)
ATGAGTACTGAAGGCATGATTGTAGAGCAATAAAGTTCCTCAGCAAATAATGTTTTGTTT
GAACCAACCTTTTACCAACCAGATATTGACGATGACAAAATGGAAGAAACAAATACCGAT
TTCTCCATGAACTAATCAACCACTGGATCAGTTTTAGATCCCTCTATATTTGCAGCTCAT
AAAGTGCGTTGCTGTATGTGCGGAATCATGATGTTACCAAATGAATCAAATACTTGCATA
AATTGCTTGAAGTCTTCTATTGATGTGACAGAGGGAATTACTAAATCGATTAATTTGAGT
CACTGCAGAGAGTGCAATCGTTATTTAAGACCACCCTGGTAATCTGCCGAATTAGAGTCC
CCTGAGCTTCTCTCACTCTGCTTAAAGAACATCAAAGGACTCAAGAGAGTAAAGTTAATT
GATGCTGGCTTCTTGTATACTGAACCTCATTCACGCAGATTGAAAGTTAAGTTAACAGTG
CAGAAGGAAGTACTTAATGGCACTCTTTTGCAATAGAGCTTCGTTGTAGAATTCGTAGTG
AATAATCTTCAATGCGATGATTGTAAGAAGACATATACCCCTCATACATGGATTGCTCAG
GCTCAAATCAGACAGAGAGTTACTCATAAACGTACCTTCTTGTTCTTGGAGTAATTGATT
ATTAAGCACAATGCAGCAGAGAAATCTCTTGGTATCAAGGAAATGCATGATGGATTAGAT
TTCCAATTCAAGAATAGATCCCATGCTAATCGTTTAGTTGACTTCATCTCAGGTACTGTC
CCAACAAAAGTCAAGACAGCCAAGTAACTCGTTTCTCACGATTTGCGTAACAACGTATTC
AGTTTTAAGTATACTTTTTCAGTCGAAATCGCCCCAATCTGTAGAGATGATCTAGCTGTC
CTTTCAAAGCCCCTCTCTTAACTATTAGGTGGTATCGGTCCCCTAGTTTTAGTTTATAAA
ATTTCAACCTTCGTGCATATTGTTGATGTTTTTACTATGCAAACTTATGAAATTGATCAA
GCTATGTACTGGAAGCATGAATTCTCAGCACTTTGTGGAAGAGATAGATTAACCGAATTT
GTAGTTCTTAATATTGAGAATACTGATTTTGATGTTAACATCAGTAGAGCAGCAGCCAAG
CAAAAGTTCAAGATGGTCCAAGTCGAAGTTGCCAGAAAGAGTGATTTCGGTAACAATGAC
AGAACATTCATTATCAATACCCATCTGGGTGAGACTCTTAACTACAATGATACAGTGCTT
GGATTCGATTTAGAAATGATTAACTTAAATGAACTTGAAGAGCTTGAATTAACTAAAACC
CTTCCATCAGTAGTTTTAGTAAGAAAGACATACCCCAGGTTCAGAAAGAGACAAAAGCAC
AGACTCTGGAAACTCAAGCATTTAGAGAAGCAAGGTCTCACAGATGAGAATATTCATGGA
CACAAGAAAAAGAAAGAAAAGACAGACTAAGGAAAACATTAGAAGGACTATGACATGTTC
TTGCAAGACATTGAAGAAGATCCTGAACTTAGACCTCAAATTGATCTTTACAGAAATGAC
GATATCATTAAGCAACTTGAAAGCAAATTGGCTGGAATGGATCTAAACAAACCCGTTGAA
GAGGAAGTTAAGGAAGTAGCAAAGCCCTCTACAGATCCAAAGAACGAGAGAAAGACAGTG
AAGGTAGTTAGAAAGACTAAAGAAGGAAAAGAGAAGTAAGAAGAATCAGAGTAATAGAGA
AAGAAGAATCAAGCTTTAATCAAAGCCAGCATGAAGGAGAAGAGTGAAGTTAAGCACGGA
AGTGACGATGGAAGTGACTGGGACAGCGTAGAAGAGGATTATCAGCACATTCAATTGGAT
GAGCTCAAGACACTAGAAGACCAGTTGGCAGGTATGTAGATTCATGGAGATGATGTCAAT
GATGAGGAGGATGCTGATAGCGATAAAGAGGAGGCTAAGAAGCCCAAGAAGAGCAAGAAA
TGA


>Contig20934.0.g47(protein)
MSTEGMIVEQQSSSANNVLFEPTFYQPDIDDDKMEETNTDFSMNQSTTGSVLDPSIFAAH
KVRCCMCGIMMLPNESNTCINCLKSSIDVTEGITKSINLSHCRECNRYLRPPWQSAELES
PELLSLCLKNIKGLKRVKLIDAGFLYTEPHSRRLKVKLTVQKEVLNGTLLQQSFVVEFVV
NNLQCDDCKKTYTPHTWIAQAQIRQRVTHKRTFLFLEQLIIKHNAAEKSLGIKEMHDGLD
FQFKNRSHANRLVDFISGTVPTKVKTAKQLVSHDLRNNVFSFKYTFSVEIAPICRDDLAV
LSKPLSQLLGGIGPLVLVYKISTFVHIVDVFTMQTYEIDQAMYWKHEFSALCGRDRLTEF
VVLNIENTDFDVNISRAAAKQKFKMVQVEVARKSDFGNNDRTFIINTHLGETLNYNDTVL
GFDLEMINLNELEELELTKTLPSVVLVRKTYPRFRKRQKHRLWKLKHLEKQGLTDENIHG
HKKKKEKTDQGKHQKDYDMFLQDIEEDPELRPQIDLYRNDDIIKQLESKLAGMDLNKPVE
EEVKEVAKPSTDPKNERKTVKVVRKTKEGKEKQEESEQQRKKNQALIKASMKEKSEVKHG
SDDGSDWDSVEEDYQHIQLDELKTLEDQLAGMQIHGDDVNDEEDADSDKEEAKKPKKSKK