Identifiers and Description

Gene Model Identifier

Contig8351.0.g1

Standard Name

NLRP8b

Aliases

Contig8351_0_g1

Description

mRNA (guanine-7-)methyltransferase (G-7-MTase)

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( pfam12803 ) mRNA (guanine-7-)methyltransferase (G-7-MTase)

Gene Expression Profile

No expression data available at this time.

Homologs

No Data fetched for Homologs

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig8351.0.g1(coding)
ATGAAAAGTTCATTTAAAAGACTTGAGATTTTAGGTCAATTTAAAAAGATAGCCGAGGAA
AACTTCTTCTTTAGATTTATAAAAGAAGGCTCGTTTAACATAGAAGAATTGATTATTGAT
AGCATCTTAAATAAATAACAACTTATCGAAATATGCAAAGCCTTAAGAATCATATTAGAT
GGGCCATAGAATCAAAACGAACTTGATAAGTTTAACAACCACAAACTCAAACGCATTACT
TTTATAAAACCTTAAGAGTTCAGTGAGGAGATTTAGATTCTAGAGAACTTGCTCGAGGAG
AAGCAAAACTTGTACTTCTTGCCTTAGTAAATGCAATAGAGAATAAAAATGCGATAGTAG
CAGTAATAACAGCTCCTTCTTGAGTAGTAACTGTAATAATAGAACAATCCTAGACCCACC
CCTAATGGCATGATGGACAGCAATTTTATGGATCCTGAGGAGTTACTGATACCTGAATAG
ATCCAATTACAATTGCAAGAATAAAATTAAAAGAGGCATTAAAGCCCATCTTAAAATCTT
GGCAACACCTAGTAACTTAAAAAAGAAGCCACTTTTAGGAAAAGCCCTAAAAGTAACAAT
CGATCTGCTGAAAAAGAAAAACTTGCAAAATCTAAAATTGAACCAATACAGGGACCTCAA
ATGCCAGGCCAGGGAGTCAATGATGATAATGGAATTGACGACGATGATATGGAAAATGAT
TTGGAATCCTCTCTGGGCTCTTAGATTAGTAAATCAGAAAGGGATGATATCGAAAGCCAA
ATTAGAAGAGATGCAGATAATAGATAGTGA


>Contig8351.0.g1(protein)
MKSSFKRLEILGQFKKIAEENFFFRFIKEGSFNIEELIIDSILNKQQLIEICKALRIILD
GPQNQNELDKFNNHKLKRITFIKPQEFSEEIQILENLLEEKQNLYFLPQQMQQRIKMRQQ
QQQQLLLEQQLQQQNNPRPTPNGMMDSNFMDPEELLIPEQIQLQLQEQNQKRHQSPSQNL
GNTQQLKKEATFRKSPKSNNRSAEKEKLAKSKIEPIQGPQMPGQGVNDDNGIDDDDMEND
LESSLGSQISKSERDDIESQIRRDADNRQ