Identifiers and Description

Gene Model Identifier

Contig20240.0.g33

Standard Name

NLRP8a

Aliases

Contig20240_0_g33

Description

Leucine Rich repeats (2 copies)

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_007131000.000000000029994712494008525Leucine Rich Repeat family pro
tein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig20240.0.g33(coding)
ATGAATAATATCGATAGTAATTCATCAAATGCGAAAAAGGATGATGAAAATGAATCTCCT
GTAAAATTTCAAGAAGAATTCATTTAGCCAAATAATAGCGATAAACATTAGTTAAAAGAT
TAGAATTAAAATATAAATGACATCTCAACTCACAATTAAACTTTCGATAATCTCATGCAC
AAAAATGATTAAGGAGGATCGCCATCATAAGAGTACAAAGACACTAAAGGTTTGAAAACT
GAGTAAGTTTCGCAATTCGGGGGCTTAAAATCTAATATGTCGACATCATATAATAAAAGC
TAAAATAATCCAACGGGTGACTACCGACAACGCATTATCGACGAAGTATAAGAATAAGAA
AACAACCTCAAAAATAATAAAAATGGGCCAACTATACCAGGACACAGAAAAAATGTTAAT
AGTGCGATGTAAATGCTTGGTAATAATAAATTTGAAGGAAGCCCTAATCAAAATAATATT
CTTGGAAATGGAATGGCATTTGATGACGAATATGGGGATGAGGAATTTGATGATAGTTTC
GAAGGAGCGGATAATTAGAGTATGTACTCGCATGTTCCTAGCTAGCACCCTATGAGTATA
GATGACGAAAGTAACAACAATCACAATGGAAATGATGGTGGGATGCAAAACTCTTATAGA
TCTGATGATTCTGACGATGAATATAACTCGAAGAGTGTGAAAAAATTGCAAATGACGAAA
AAAGAATTAGCTCCAATAATGTTGTATTAAATTGGCTTCCTAGCTTGTATTATACTCCCT
CCTCTAATGCTGTATTAAGACTGCAGAACTTCTCCTAATTTTATTTCTCACATTATTTTT
GCTGTACTTCAGATCATGTTGTTCGTGATATCTACATTCTATCATAGAAAGAAAAATGGG
GGTGGAGGAATTTCTGGTACTACAAATTTCACTGGTTCAGGTATTGATAATTCAAGTAAT
TTAATGAGATCCTAAGGTAGATGTTGCAGAGAGATACTTTCACATATGAAGTTGATAGAC
ACCTACACAAATTTATGCTTCTACTCACTTGTTCTAAACCAAAGAGATAGACTGCCTATG
TATGTATTCGCAATAAGCACTACTAGTGTAATTGTCACACTTTTAGTCAAATTCGGCATT
ATTGGATATTTCGTGGTTTTTATTGTCTGCAAAATGCGGAAATTAGATGATAATAAAGAG
TAGGCAAAAAACGATGAAGAAAGAGAAGATGGTACGTTGATGAAGAAAACTATATCTTTG
AATATTTTATACTAGAAAACTCTTACTAAGCTGCTTATTTGGCTTGATTAAGACACTATA
GCAAAGCTTTATGACCCAGACATGGAGCAAGGGGAATCCCAATTATTTGTATACCACAAG
CATAGATATTCTTACATTAAAGCTATTATTGAAGACGGCCCTCTGGCAGCTATGTAAGCT
CTATATCTCTCCCAAGAAACTTGCAGCAGTGGCTTAAATTCAATTATCATCATTAGTTTG
TACTTCAACTCCGTCTGCCTTCTTTATTCACTCAGTAATCTCTGCTCAAGTAAAAACAAA
GAGGAAAGTGGGTCTAAAGTGTACAAGAAAGAGTTAGATAGGCTGAGGGACTACTACGAT
GGGAATCAAGCCAGAGTGATTGCTGAGTTTTACATTGAAGATCAGAGTGACATCCAAACT
ATGAAAATGAAGGCACTAAACGACTTCTTATCATATCATGAATATGACGTCTAATCATTC
AATTTCTCCACAAATTAGATGAGTGAAGAGACCATTAATTATCTCCAAGAAATAATTGTC
AATTCTTCTGAGTCTCTTGAAGATCTTACTCTCTCAAGGTGCAGACTTAAATCAATCCAC
ATCTCATTCTTCTACTATCCACAATGCTTGATAAAGTTAAATCTATCTGAGAATAGAATA
GGTGATAAGGGTGCTTAATTAATAGCAAGTTACTTGCAAGAAAAGAACAGATCTAATCTT
CTCATGCTCAATCTTGAACATAACAATATTAGTGAAGTTGGTGCTTTAAATTTACTGAAA
GCAATAACAAACTCATCAATTATACACTTTAACATCAAGAAAAATAGAGGGGATGTACTC
ACATAACAGTTTAGTCTCCAACTTGTCTTTGAGTATTTCAAGGTCTTGTAGTTAAACTAT
ATAAGATACTTCATTAGAATTAAGTAGATGGCTAATGGAAACAAAATGCAAGAATAATTC
ACAGTGAAGGTTTCATTTAGTGATCAGCTGGATCGTATATTGCAAAGCTTATTTAAAATT
GATTAAGTACCTACCATAAGAAGTCTTGATTTGAGCATGCGTTTCTTCAGATCAATGAGA
GCGAATAAACTTAAAGATTAAAACGGGCAGGTCAAATAACTCTTATTGAAAGGCCTTTAA
TTTTATGATGATGAGCAGAGAGTCATATTGATAGCTTTACACTATAATGCTAATTTACTT
AAAAACATACCTGATTAAGAAAGGATCATGCTAGATAAACTCGGAACATTAATACCTGCA
ATAAACTGGCATTACTTGGGTAACTCAGTAAACACAATAAATCTTTCTTCTAATTGGTTC
TCTGCAAGAGCTCAATCTATGATATTCAACTCGTTCACTAATTTTACTAACCTCAAGGAA
ATGATATTCAATAACAATTACATTAAGAATACTGGAATGTTTTTCAAGTGCTTGGCTGAC
TGTACTAGTCTAGAGTCCCTATATCTAAAATCATGTTCCTTCTATGGGTTTTACGAAATA
GAGTTTAAATCATGTTTCTACAGAATGATGAATTTAAAAGATTTACACCTTAGCTACTCT
AATGTAAATGACACCACAATTATTAGTTTAGCCGATTGCATACCTTAAATGACTCAGATA
GCCAAAATCAATGTGAAATAATGCGGTATCACACATGCCTCAATCGATTAGTTATTTGAG
AAATTGGGAACAAGTCATTCTATTTAATCTCTAAATCTAAGTTAAAACGATTTAAATGGT
ATATTACAGCTTGGTAAATTCATTAAAACTAATAAAACAATTGAGAAATTGAAACTATCA
AAAACTTAACTAAGTGATAATGAACTCAAACAGATCAGTTATGGCTTGAAAATCAATAAA
TCCCTCTAGATCTTAGATCTTTCATAAAATCAAATAGTGAATGTCGGTTAAATAAAAGAA
GGTTTGAGTTGTAACATAGCCTTGGAGAAGTTAGACATTTCAAATAATATGATTGACGAT
TCTGGCTTGATTAAATTGTCACAGTCATTGGTTAGTAATGGATGTTTGGAAACGATATCA
ATATCTTTTAATGATTACTAAGTTGCAGGGCTTAGTGAATTCTTCAAGATATTTGAAGAG
AATGAATCACTATAAAATGTCTCTTTTTCTATACCAAACAACATAATTGAAAGGGATCTA
TCTTAATTAGGCCGAGCTTTAATAGATACATTAGTAATGATGAAAAGTTCATTTAAAAGA
CTTGAGATTTTAGGTTAATTTAAAAAGATTGCCGAGGAGAACTTCTTCTTTAGATTTATA
AAAGAAGGCTCCTTTAACATAGAAGAATTAATCATTGACAGCATCTTAAACAAGTAACAG
CTTATCGAAATATGCAAAGCCCTAAGAATCATATTAGATGGCCCATAGAATCAAAATGAA
CTTGATAAGTTTAACAACCACAAACTCAAACGCATTACTTTTATAAAACCTTAAGAGTTC
AGTGAGGAGATTTAGATTCTAGAGAACTTGCTCGAGGAGAAGCAAAACTTGTACTTCTTG
CCTTAGTAAATGCAATAGAGAATAAAAATGCGATAGTAGCAGTAATAACAGCTCCTTCTT
GAGTAGTAACTGTAATAATAGAACAATCCTAGACCCACCCCTAATGGCATGATGGACAGC
AATTTTATGGATCCTGAGGAGTTACTGATACCTGAATAGATCCAATTACAATTGCAAGAA
TAAAATTAAAAGAGGCATTAAAGCCCATCTTAAAATCTTGGCAACACCTAGTAACTTAAA
AAAGAAGCCACTTTTAGGAAAAGCCCTAAAAGTAACAATCGATCTGCTGAAAAAGAAAAA
CTTGCAAAATCTAAAATTGAACCAATACAGGGACCTCAAATGCCAGGCCAGGGAGTCAAT
GATGATAATGGAATTGACGACGATGATATGGAAAATGATTTGGAATCCTCTCTGGGCTCT
TAGATTAGTAAATCAGAAAGGGATGATATCGAAAGCCAAATTAGAAGAGATGCAGATAAT
AGATAGTGA


>Contig20240.0.g33(protein)
MNNIDSNSSNAKKDDENESPVKFQEEFIQPNNSDKHQLKDQNQNINDISTHNQTFDNLMH
KNDQGGSPSQEYKDTKGLKTEQVSQFGGLKSNMSTSYNKSQNNPTGDYRQRIIDEVQEQE
NNLKNNKNGPTIPGHRKNVNSAMQMLGNNKFEGSPNQNNILGNGMAFDDEYGDEEFDDSF
EGADNQSMYSHVPSQHPMSIDDESNNNHNGNDGGMQNSYRSDDSDDEYNSKSVKKLQMTK
KELAPIMLYQIGFLACIILPPLMLYQDCRTSPNFISHIIFAVLQIMLFVISTFYHRKKNG
GGGISGTTNFTGSGIDNSSNLMRSQGRCCREILSHMKLIDTYTNLCFYSLVLNQRDRLPM
YVFAISTTSVIVTLLVKFGIIGYFVVFIVCKMRKLDDNKEQAKNDEEREDGTLMKKTISL
NILYQKTLTKLLIWLDQDTIAKLYDPDMEQGESQLFVYHKHRYSYIKAIIEDGPLAAMQA
LYLSQETCSSGLNSIIIISLYFNSVCLLYSLSNLCSSKNKEESGSKVYKKELDRLRDYYD
GNQARVIAEFYIEDQSDIQTMKMKALNDFLSYHEYDVQSFNFSTNQMSEETINYLQEIIV
NSSESLEDLTLSRCRLKSIHISFFYYPQCLIKLNLSENRIGDKGAQLIASYLQEKNRSNL
LMLNLEHNNISEVGALNLLKAITNSSIIHFNIKKNRGDVLTQQFSLQLVFEYFKVLQLNY
IRYFIRIKQMANGNKMQEQFTVKVSFSDQLDRILQSLFKIDQVPTIRSLDLSMRFFRSMR
ANKLKDQNGQVKQLLLKGLQFYDDEQRVILIALHYNANLLKNIPDQERIMLDKLGTLIPA
INWHYLGNSVNTINLSSNWFSARAQSMIFNSFTNFTNLKEMIFNNNYIKNTGMFFKCLAD
CTSLESLYLKSCSFYGFYEIEFKSCFYRMMNLKDLHLSYSNVNDTTIISLADCIPQMTQI
AKINVKQCGITHASIDQLFEKLGTSHSIQSLNLSQNDLNGILQLGKFIKTNKTIEKLKLS
KTQLSDNELKQISYGLKINKSLQILDLSQNQIVNVGQIKEGLSCNIALEKLDISNNMIDD
SGLIKLSQSLVSNGCLETISISFNDYQVAGLSEFFKIFEENESLQNVSFSIPNNIIERDL
SQLGRALIDTLVMMKSSFKRLEILGQFKKIAEENFFFRFIKEGSFNIEELIIDSILNKQQ
LIEICKALRIILDGPQNQNELDKFNNHKLKRITFIKPQEFSEEIQILENLLEEKQNLYFL
PQQMQQRIKMRQQQQQQLLLEQQLQQQNNPRPTPNGMMDSNFMDPEELLIPEQIQLQLQE
QNQKRHQSPSQNLGNTQQLKKEATFRKSPKSNNRSAEKEKLAKSKIEPIQGPQMPGQGVN
DDNGIDDDDMENDLESSLGSQISKSERDDIESQIRRDADNRQ