Identifiers and Description

Gene Model Identifier

Contig2182.0.g76

Standard Name

NIPP1

Aliases

Contig2182_0_g76

Description

FHA domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_001580501.9998323414791308e-36FHA domain containing protein
SGDYLR016C0.00010003404299092957PML1 SGDID:S000004006, Chr XII
from 177416-176802, Geno...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig2182.0.g76(coding)
ATGTCAGAAATTTAATAGTAACAAAAACAAGCAAGCTTATCACATTAGGCACAGGATGAA
ATTAATAGCAATTTGTAAAGCTTAAAACAGCAATTTGAAGTACTTGAATATTTAGAACCT
TTCTGGTCTTCTCCTCCTATCTACGATTACTATTTTGAGGTATTGAAGGATGGAGCAATC
ATCGAAGAAATAGACCTATCGAAAAAGTCATTCTATTCCATCGGTAGACAAAAGGACACG
GTGGACATACTTATGGAAAATCCAACAATCTCAAGAAAACATGCTATAATACAGCACAAA
GACACAGGCGATATTTTCATATATGATTTGGGAAGTACTCATGGAACCTTTGTGAATAAG
AGATAAATCCCAGCTAATCAATACATCAAGCTCTCTTTAAATGATTAAGTGAGGATTGGC
TAGTCTACTAGAATTTTACTTTTGAACGGACCAGAGGAAGCTGAAATTTAAGCTTAAGAG
GAGGTAGAAGAAAAAGACGATTAACCTCGCAAGAAAATACAAATTGTCTCTAAAAAGTAG
AATAAGGAGTTCCTATTTAAAAGAAGATTGGATTAGCTTAAGAAGTTTCATGACTAAGTG
AATTAGCTTCATGATTAAAAACTTCAGAGAATTCACGGAAATGAAGATGAAGGAGTCTCT
TGGGGTATGGGCTTTGAAGAGGATGAAATAGCGGAGTATCAAAGAAAGATGGATGAAGAG
GGGGATGATGAAGAATCCAGAGAAGGCTTTAGTGATGAAGATTCTGATAATGGCAACAGC
GATGATGACGATGTGAAACTATTGAATGTTGAAGCATTACGATAGAGAACTGACTTGACC
GAGAAGCAGACCTAGATGCTTAATAAAGTTGAAGGAATCAGAAGGCAACTCAAGAAACTT
CTTGATAAGAAATCCAAACTAAAAAACGATTAGGACATGGAATTTGATGATAAACCAATA
CAAGGATAACTAAAAGGCATTGATAAGAAATGTCAAGAAATGAAGGAGCAACTTGAAAAG
ACTGAGAAAAAGCTCAAGACCTCACTTAGAGCTAAGAAGAGTAGGCCATAGAAGACTAAT
AAAGAAATAGAGTCAGAAACCGTTTTTAAGTATCACAATAGTGATGATGAGGAAGATGAG
TTCTTTGATAGAACAAAAAAGACTTTATTCAATAAGAACAAGTAGCAGTATCAACTAGAT
AATGGTGAAGAAGTGGAAACTTATGATACCTTAAAGTTTAAGTTAGAATAGTTATATCGA
TAAAGATAGAAACTTACTGAAGAGATGTAAAACGGTCCAGATGACAAATCTAAAAGTTCA
CAAGATGAAGATTATGATGAATTGGAAGCTTTCATGAAGCAAAACACTGATTTACTGAGG
ATAGAACAACAAAAGAAACTTGGAGCATAAATTGTAGAGGTGAACAAGGAAATTGATAAA
TATACTCAGCTTATAGCTATGGTTGCTCCAACAACATTCCAATAAAGAACCTAAGCTAAA
TAATAGAATCAATAGCAAGAAGAACCATCAATTCCTAATGATTAAGTATAATAAGAAACT
AAGCAGGAGGAGGACAAATAAAAACCTACAAAAGATTTACCAGTTTCAAAGCCAAAGTAA
ACCTCAGGTCTCTCTAGTACAATGTAAAGATTGAAAGAAATGTCTGAAATTAAAGAAAGA
GAACAGGAAGAGAGGAGAAGACTTTAAGAACAGAAAGATAGAGAACAAGAGGAAATAATC
ATGCAGAGAAGGATTTAGTAAGTTTAAGAGAGAATTCTGAGAGAAGGAAGGCTTGACTAA
GGACTTGATGAGGATGAAGAGGAAGACGAAGAAAGCACGGGTTTAGACTAAGAGAGTGGC
TTGAGAAATTACTTCAGAGAGATTGTGGAAAATGCGAATAGAAACGGTGAAAAGATTGAT
ATAACCAAATACTCAAATCTACTTGGTGAGTATGATAAGCAATCAAACTCTAGAAAATCA
CTCTAGGGCTCTGTTTCATACTTGGAGACTGAAATAAGAGGAGGGGGAGTTGGGCTATAA
GTCAAAAGACCAAAAGTCTATGAATCTATGGCTTAGCCAAAACATCGTAACCTAAATAAT
GATATTGAGGATGAGAAGAGAGAGGGTGAAGTCGATGATTGGATTCCACCTACTGACTAG
AAAGGTGATGGTAAAACTAGTCTTAATGAAAGGTTCGGATATTGA


>Contig2182.0.g76(protein)
MSEIQQQQKQASLSHQAQDEINSNLQSLKQQFEVLEYLEPFWSSPPIYDYYFEVLKDGAI
IEEIDLSKKSFYSIGRQKDTVDILMENPTISRKHAIIQHKDTGDIFIYDLGSTHGTFVNK
RQIPANQYIKLSLNDQVRIGQSTRILLLNGPEEAEIQAQEEVEEKDDQPRKKIQIVSKKQ
NKEFLFKRRLDQLKKFHDQVNQLHDQKLQRIHGNEDEGVSWGMGFEEDEIAEYQRKMDEE
GDDEESREGFSDEDSDNGNSDDDDVKLLNVEALRQRTDLTEKQTQMLNKVEGIRRQLKKL
LDKKSKLKNDQDMEFDDKPIQGQLKGIDKKCQEMKEQLEKTEKKLKTSLRAKKSRPQKTN
KEIESETVFKYHNSDDEEDEFFDRTKKTLFNKNKQQYQLDNGEEVETYDTLKFKLEQLYR
QRQKLTEEMQNGPDDKSKSSQDEDYDELEAFMKQNTDLLRIEQQKKLGAQIVEVNKEIDK
YTQLIAMVAPTTFQQRTQAKQQNQQQEEPSIPNDQVQQETKQEEDKQKPTKDLPVSKPKQ
TSGLSSTMQRLKEMSEIKEREQEERRRLQEQKDREQEEIIMQRRIQQVQERILREGRLDQ
GLDEDEEEDEESTGLDQESGLRNYFREIVENANRNGEKIDITKYSNLLGEYDKQSNSRKS
LQGSVSYLETEIRGGGVGLQVKRPKVYESMAQPKHRNLNNDIEDEKREGEVDDWIPPTDQ
KGDGKTSLNERFGY