Identifiers and Description

Gene Model Identifier

Contig10478.0.g26

Standard Name

NIP7

Aliases

Contig10478_0_g26

Description

Uncharacterised protein family (UPF0113)

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( pfam03657 ) Uncharacterised protein family (UPF0113)
  • ( pfam13636 ) pre-rRNA processing and ribosome biogenesis

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_005902401.9993206333383003e-8060S ribosome subunit biogenesi
s protein
SGDYPL211W4.000308233752481e-69NIP7 SGDID:S000006132, Chr XVI
from 153495-154040, Geno...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig10478.0.g26(coding)
ATGAGACCATTAACAGAAGACGAAACCAAGACTTTCTTCAACAAGTTAGCTAAATTTATG
GGTTCAAACATTAAGTTCCTCATCGACAGAGAAGACGGAGATTACGTTTTCAGACTCCAT
CATAACAAAGTGTTCTATTTAGATTCAAGCGTACTCAAGATGGCCTCCCACATTGGAAGA
GATGAATTAATCAGTGCAGGCACTATTTTCGGTAAATTCACAAAGGCAGGCAAATTCAAG
TTGCAAATCACTTGCTTGGACTACCTCGCTAAGTATGCCAAATTTAAGATTTGGGTTAAG
CCAAATGGTGAACAAACATTCTTGTATGGAAATCACGTGCTGAAGGGTCACTTAGCTAGA
ATCACAGAAAATACCCCAGCTAATCATGGTGTGGTCGTGTTTTCCATCAGTGACATCCCA
CTTGGATTTGGAATGTGTATGAAGACCACTGCTTAGTGCAGAGACTTAGATCCAACTCAT
GTCGTAGTTATCAATCAAGCAGATGTTGGTGAATATCTCAGATGCGAAGAAGAAATTTGA


>Contig10478.0.g26(protein)
MRPLTEDETKTFFNKLAKFMGSNIKFLIDREDGDYVFRLHHNKVFYLDSSVLKMASHIGR
DELISAGTIFGKFTKAGKFKLQITCLDYLAKYAKFKIWVKPNGEQTFLYGNHVLKGHLAR
ITENTPANHGVVVFSISDIPLGFGMCMKTTAQCRDLDPTHVVVINQADVGEYLRCEEEI