Identifiers and Description

Gene Model Identifier

Contig12345.0.1.g47

Standard Name

NHP2

Aliases

Contig12345_0_1_g47

Description

Avian retrovirus envelope protein, gp85

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( pfam03708 ) Avian retrovirus envelope protein, gp85
  • ( pfam00521 ) DNA gyrase/topoisomerase IV, subunit A

Gene Expression Profile

No expression data available at this time.

Homologs

No Data fetched for Homologs

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig12345.0.1.g47(coding)
ATGTCAGATCTTCACTAAAGCTATGAATCTACATTGATAGTGCCGCAAAGTATTGATGCA
AAGGACATGACAAAGGTTTTATGCGATGATTGTCAAATGGTTCCACTCCTGCCAGTTAGA
TGCTTCAAGACTAACAAAATTTACTGTTAAGGGTACTTCTATGACTACGTTTAGAATCAT
AATACTTCACCAGCTTATAGAGTCCAAAATGGAGGGCTAAATTTAAAAGAAGCTTAAGGA
AGTCTTGAAGAAAGAAATTAACTACTATAGAATTGCAATCTTACACCAGAATAAGTATAG
TTGTTTTCCAGGCTACAACTTAAATGCCCTAATCACATCGTTGGGTGTTCAGTCGTTTCA
AATCACAGTGAAATTCTTGATCATTATACTTAATGTTTGAATGTATGCACATTTTGCAAT
CAGCCATACCTTATGGCTTTGTAAAGCCTTCATCAATCATAATGCTAATCTTATCAAGAG
TTCATTGAAGGGCAATAAACTTAGAGCAGAGAATAAGCTGAGCAGAGATTGAAGACTGCT
TAATAAATCGCAGAGAAGGAAGCAAAGCTAAAAATACTTTAGAATGAAATCAAAGAACAG
GAGATGGTTTTAGAGAGCAAGAGAAATAAGCTTTTCAAAACGAAAGTTGTTTCACTGATG
CTTGTCATAATTGCAGTTCTTCATGTTTTCAACTACCATGAAATCTAAAAAGAATAGAAT
GAAAGTTTAAGAAGCTATGAAGCTATTTCAGAACTTTTGAATCAGCCCATCTTTATTAAC
TTACAAAGAGAAACTTCGTTGCAACATAAGCTGATAAGATTTGAAGAAGCCCTAAAAGAC
TTGAAGAAAAATTTAGATCCTGAAGATCAAAGCTCACTATTTGATATTGATAGATTCAGA
GATCAACTTACTTTGGGTGACTACTACTGTGAGTACTTCTCATAGCTCTATTATCTCATC
TTCAATATTTAACATCAAAGCCACTCATACACCAAGCAACTTGGCACAAAATGTGCTCCA
TAAAAAAGAAGAAGCGAAATGAGACAAGGAGTGGGTAAAGAATGCTTAAAGAAACAGCTA
GGAAATAATCCAAATGCCTACTAAGAAGCAACTGAAAGCATCAAAAGACTTAAGGATATT
TTGAATAGACAAGATTTGAGTTTTAATGAGCATGAAAAGATGGAGCTCAGAGAGTTCTTT
AACAAAGTCGAGAATGCAGTAGAATTCCTTGATAAACCAAGAAAAGCAGCTGTTCATCAG
TCGATTCATTTGCTAAGGGAAGAACTGGGAGTTATGTGA


>Contig12345.0.1.g47(protein)
MSDLHQSYESTLIVPQSIDAKDMTKVLCDDCQMVPLLPVRCFKTNKIYCQGYFYDYVQNH
NTSPAYRVQNGGLNLKEAQGSLEERNQLLQNCNLTPEQVQLFSRLQLKCPNHIVGCSVVS
NHSEILDHYTQCLNVCTFCNQPYLMALQSLHQSQCQSYQEFIEGQQTQSREQAEQRLKTA
QQIAEKEAKLKILQNEIKEQEMVLESKRNKLFKTKVVSLMLVIIAVLHVFNYHEIQKEQN
ESLRSYEAISELLNQPIFINLQRETSLQHKLIRFEEALKDLKKNLDPEDQSSLFDIDRFR
DQLTLGDYYCEYFSQLYYLIFNIQHQSHSYTKQLGTKCAPQKRRSEMRQGVGKECLKKQL
GNNPNAYQEATESIKRLKDILNRQDLSFNEHEKMELREFFNKVENAVEFLDKPRKAAVHQ
SIHLLREELGVM