Identifiers and Description

Gene Model Identifier

Contig13008.0.g43

Standard Name

NGDNc

Aliases

Contig13008_0_g43

Description

Sas10/Utp3/C1D family

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_003750983.9992896861436003e-19Protein C14orf120, putative

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig13008.0.g43(coding)
ATGCCAAAACACCCCAAGATGCCTGCTAATAAAAAAGTCATTCCTGCTAAAAAGGAGTAA
GTGATAGATAAAACTTAGAAGAAATCCTTGTTTGAGTCTGAAAGTGATGAAGATGACTAC
AAAAGTGATGATAATGCATTAGTTAATGCTAAGAATGATGATGATATGCAAGAGAGCAGC
AGTGAGTTTGATGATGAGGATTATGATATCGAGGTGGAAGGAGAAGACGATGAAGAGGAG
TCTGATGATGATGACATGGAGGATTAATCTGATGACTCTGATGATGAAATGATCATCAAG
TACAAGGAATTGATTGAACATTAATAATCACAACTTAAGCCACTACCAGAACATAAGAAA
TAATTAAACGGGAGGAGTACAGAGCCCATTAATGGCAAACAACCTCAGGAAAATGGTAAA
GTACAATCGACTCCAGTATAAAATGGCAAAACTTCTCAATAAAAACCAAAAGCAAAGCCA
GTAACACCCCCTAGTGAATCAGACTCAGATGAAGAAGAGGAGTCTTTAATTAATAACTAA
AACGGAGTGATTGAAGTAGACCCCAAACTTGTGAAGTAAATTATAGAGAAAGATTCCCCA
GAACTAAACCGCATACTTGGGGAATTTATCTAAAACGTAGATAACCTTAACAATAAGCTC
AAACCTATGATGCAGAAAGTTTTTGATAAGAATAGTGGCCTTGAAACTAAACATGGAATG
ACCTACCTCGAGATGAAATATAACCTATTGAGCTCATACTGCTAATTCCTTTCATTTTAC
CTGTTATTGAAATTAGAAGGAAACCAAGACATAGAATCACATCCAGTAGTGGATAGACTT
TTGCACATAAAAATTTTGCTTGAAAAACTTAGACCTTTGGATTAGAAATTACAATATCAA
ATTGATAAAATGCTCAGGACAGCTGCTTTGGCTGATGCCTCAGGCAATATTGAGCCTGGT
GAAGAAGTTAGCAATTAGATCACTGAAAATCCTCTGCAATACAGACCAAATCTTGACAAT
CTCAGAGACTTAACAAATATGGATTAAGATGAGGAAAGCGAAGATGAAGACAATCAAAAG
CCTGAGGATTCAGACGATGGAGAAGACGAAGAAGACCCATCAAAGAAGCAAATCTACAAA
GCTTCAAAAATGAACCCAGTGTTCTTTGATGACAAGAAAACCAGAAAGACTAAGAGAGAC
GAGGAAGCGCACAAACGCAAAATGGCAAATTCAGACTATGTGGAATAAATTCGCAAGGAA
ATCTATGATGAGCCTGAGGAAGTCCATCTTGGTGGTATGCTCAATAAAAAGTCCAAATTT
GCCAAGGAGATGGAACAGATGGAATCACTAGAGCAAGAGCACTTCAAGCGCATGAGTTTC
TCCAAGAAAGAACTCAAAAACATTAAGTAACAAGAGAAGCAGCACTTCCAAGAGAGACTT
GATTAATTCGATGATTTGAGAGACATTGAGAATATTTTGGGAAGCAGGTCTAGAAAGGAC
AGAGAAGAAATTGAGATGGACGCATAGATGGAGAACAAACAATTCCAGAAAAACCTAAAG
ACATACATTAAAAGCAGTGGCCCAAATCAATTCAACAACAAAAAGAGAGACTAGAAAGCA
GGATTTAAGGATTAAAAGTCAGGTTTTAAGAATCAAAACAAGACTTTCTAGAAAGGCGGT
TTTAACAACAAAAACAAGAATGGCAATAATAGGAGATGA


>Contig13008.0.g43(protein)
MPKHPKMPANKKVIPAKKEQVIDKTQKKSLFESESDEDDYKSDDNALVNAKNDDDMQESS
SEFDDEDYDIEVEGEDDEEESDDDDMEDQSDDSDDEMIIKYKELIEHQQSQLKPLPEHKK
QLNGRSTEPINGKQPQENGKVQSTPVQNGKTSQQKPKAKPVTPPSESDSDEEEESLINNQ
NGVIEVDPKLVKQIIEKDSPELNRILGEFIQNVDNLNNKLKPMMQKVFDKNSGLETKHGM
TYLEMKYNLLSSYCQFLSFYLLLKLEGNQDIESHPVVDRLLHIKILLEKLRPLDQKLQYQ
IDKMLRTAALADASGNIEPGEEVSNQITENPLQYRPNLDNLRDLTNMDQDEESEDEDNQK
PEDSDDGEDEEDPSKKQIYKASKMNPVFFDDKKTRKTKRDEEAHKRKMANSDYVEQIRKE
IYDEPEEVHLGGMLNKKSKFAKEMEQMESLEQEHFKRMSFSKKELKNIKQQEKQHFQERL
DQFDDLRDIENILGSRSRKDREEIEMDAQMENKQFQKNLKTYIKSSGPNQFNNKKRDQKA
GFKDQKSGFKNQNKTFQKGGFNNKNKNGNNRR