Identifiers and Description

Gene Model Identifier

Contig11925.0.g28

Standard Name

NGDNb

Aliases

Contig11925_0_g28

Description

Sas10/Utp3/C1D family

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_003750982.000769134519826e-18Protein C14orf120, putative
SGDYER127W0.00020003864201578029LCP5 SGDID:S000000929, Chr V f
rom 414481-415554, Genome...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig11925.0.g28(coding)
ATGCCAAAACACTCCAAGAAGTCTGCTAATAAAAAAGTCATTCCTGCTAAAAAGGAGTAA
GTGATAGATAAAACTTAGAAGAAATCCTTGTTTGAGTCTGAAAGTGATGAAGATGACTAC
AAAAGTGATGATAATGCATTAGTTAATGCTAAGAATGATGATGATATGCAAGAGAGCAGC
AGTGAGTTTGATGATGAGGATTATGATATCGAGGTGGAAGGAGAAGACGATGAAGAGGAG
TCTGATGATGATGACATGGAGGATTAATCTGATGACTCTGATGATGAAATGATCATCAAG
TACAAGGAATTGATTGAACATTAATAATCACAACTTAAGCCACTACCAGAACATAAGAAA
TAATTAAACGGGAGGAGTACAGAGCCCATTAATGGCAAACAACCTCAGGAAAATGGTAAA
GTACAATCGACTCCAGTATAAAATGGCAAAACTTCTCAATAAAAACCAAAAGCAAAGCCA
GTAACACCCCCTAGTGAATCAGACTCAGATGAAGAAGAGGAGTCTTTAATTAATAACTAA
AACGGAGTGATTGAAGTAGACCCCAAACTTGTGAAGTAAATTATAGAGAAAGATTCCCCA
GAACTAAACCGCATACTTGGGGAATTTATCTAAAATGTAGATAACCTTAACAATAAGCTC
AAACCTATGATGCAGAAAGTTTTTGATAAGAATAGTGGCCTTGAAACTAAACATGGAATG
ACCTACCTCGAGATGAAATATAACCTATTGAGCTCATACTGCTAATTCCTTTCATTTTAC
CTGTTATTGAAATTAGAAGGAAACCAAGACATAGAATCACATCCAGTAGTGGATAGACTT
TTGCACATAAAAATTTTGCTTGAAAAACTTAGACCTTTGGATTAGAAATTACAATATCAA
ATTGATAAAATGCTCAGGACAGCTGCTTTGGCAGATGCTTCCGGCAATATTGAACCTGGT
GAAGAAGTTAGCAATTAGATAACTGAAAACCCTCTGCAATACAGACCAAATCTTGACAAT
CTAAGAGACTTAACAAATATGGATTAAGATGAGGAAAGCGACGAAGACAATCAAAAGCCT
GAGGATTCAGACGATGGAGAAGACGAAGAAGACCCATCAAAGAAGCAAATCTACAAAGCT
TCAAAAATGAACCCAGTGTTCTTTGATGACAAGAAAACCAGAAAGACTAAGAGAGACGAG
GAAGCGCACAAACGCAAAATGGCAAATTCAGACTATGTGGAATAAATTCGCAAGGAAATC
TATGATGAGCCTGAGGAAGTCCATCTTGGTGGTATGCTCAATAAAAAGTCCAAATTTGCC
AAGGAGATGGAACAGATGGAATCACTAGAGCAAGAGCACTTCAAGCGCATGAGTTTCTCC
AAGAAAGAACTCAAAAACATTAAGTAACAAGAGAAGCAGCACTTCCAAGAGAGACTTGAT
TAATTCGATGATTTGAGAGACATTGAGAATATTCTGGGAAGCAGATCTAGAAAGGACAGA
GAAGAAATTGAGATGGACGCATAGATGGAAAACAAACAATTCCAGAAAAACTTAAAAACA
TACATTAAGAGCAGTGGCCCAAATTAATTCAACAACAAAAAGAGAGACTAGAAAGCAGGA
TTTAAGGATTAAAAGTCAGGTTTTAAGAATCAAAACAAGACTTTCTAGAAAGGTGGCTTC
AACAACAAAAACAAGAATGGCAATAATAGGAGATGA


>Contig11925.0.g28(protein)
MPKHSKKSANKKVIPAKKEQVIDKTQKKSLFESESDEDDYKSDDNALVNAKNDDDMQESS
SEFDDEDYDIEVEGEDDEEESDDDDMEDQSDDSDDEMIIKYKELIEHQQSQLKPLPEHKK
QLNGRSTEPINGKQPQENGKVQSTPVQNGKTSQQKPKAKPVTPPSESDSDEEEESLINNQ
NGVIEVDPKLVKQIIEKDSPELNRILGEFIQNVDNLNNKLKPMMQKVFDKNSGLETKHGM
TYLEMKYNLLSSYCQFLSFYLLLKLEGNQDIESHPVVDRLLHIKILLEKLRPLDQKLQYQ
IDKMLRTAALADASGNIEPGEEVSNQITENPLQYRPNLDNLRDLTNMDQDEESDEDNQKP
EDSDDGEDEEDPSKKQIYKASKMNPVFFDDKKTRKTKRDEEAHKRKMANSDYVEQIRKEI
YDEPEEVHLGGMLNKKSKFAKEMEQMESLEQEHFKRMSFSKKELKNIKQQEKQHFQERLD
QFDDLRDIENILGSRSRKDREEIEMDAQMENKQFQKNLKTYIKSSGPNQFNNKKRDQKAG
FKDQKSGFKNQNKTFQKGGFNNKNKNGNNRR