Identifiers and Description

Gene Model Identifier

Contig152.1.g19

Standard Name

NGDNa

Aliases

Contig152_1_g19

Description

Sas10 C-terminal domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
SGDYDL153C0.00000000000004998767099442072SAS10 SGDID:S000002312, Chr IV
from 183018-181186, Geno...
T. thermophilaTTHERM_005903200.00000000000006002591555650462hypothetical protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig152.1.g19(coding)
ATGCCTAAAAAGCAGCAGCGAAACATCAAGCCAGCTTCCAGTGATGAGGAAGATGACAAT
GATATGGGGTCTTCCTATGATGATGAAAGTGGAAGTGATTTAGGCAATAACGATAATCGT
GAGATGGTAGTAGATAAGAAGCATCTGCTAAATTACGAGAGTGACGATAGCGATGATGAC
GATAATGGCATGGGTTCAGACTCTGATGACTTCGGCAAAGAACTCCAGAAGCAGAAGGAA
GATTTGAAGATGAACGACACCTGGGGCAGCAAGAAGAAGAACTTCTATGGCAGAGACAAG
AAAGGAGGGGATGATATCACTTCAAGTGAAGACGATGAAGATGAGCGTTTAGAGGCACTT
AGACTTCAGAAAGTTAGAGCTAAGAAGCTATAAATGATGGCTTAGTAACAGCAATAGGAC
TAGGACGCAGAAGTCGATGGGAAAGCGAGCAAGAAAATCACAGGTTTGATCAAGAGTGAT
GAGGATGAGGAGAGCGAAGATTCAGAAGAAGATTTCGCACAACGCAGATTAAAGAGTAGA
CTGGGAGACAAATTATTCGCAGAGGATCAGACTAACACAAAGTCATAGAACTCAAAAGCA
GACAACTCAGTCAACAAAATGAAGGAGTTAATTAAGGAAGTCCAAAACCCTAAGACCATT
AAAGCTATAATTGAGAAGGAAAACCCTGAATTACTTGGATTACTAGAAGAATTCCAATAC
AGTCTCGATGACATTAACACTAAATTAAAGCCAATCTTAGATCACGCTAATAGTTTCAAG
AAATCCCATAAAAACACGCTTACATACATAGAAATGAAACATAATTTGCTCTTATCATAC
TGCACTTTCCTCAGTTTTTACCTACTTTTGAAGGTTGATGGTAAATAAGTGCAAAATCAT
CCAGTTTTGTTCAAAATCACACATATCAAGGGACTATTAGATAATTTAAGGCCTGTTGAT
GAGAAATTAGAGGGTCAATTACTTAAAATGTTAAAATAAATTAAGAAAATTGAGAAAAAG
CAATAGAAAGCTGATGCTAAGAAAAAGAAGGAACTGCCTAGTGATGTGGAGGAATATGAC
GAAGAAGAGGAGGGCAATCAGAGTGAAATCGATATGGATGAGTATGATATGGAAGATGTA
AGCGACGTTGAAAATGAATAATACGAAGAAGATGGTGAAGAAGACGAAGAAGATGACTAT
GATGATGAAGAAGATCTAGAGGATGAAATGGAAGAAATGGAAGAAGACATGGATGATGAA
TATGACGAAGAAGAATAGGATGATAAATACGACAGAGATGATGGTGTGAGCATGAACATC
ACTGACCTAGAAAAGCTATATGAATTTAAGAACGGTAAATTAGTCAAGAAAGCTGGTGTT
GTCAATGAATTCGAGAATAAAGAACCAAAGACTAAAGAAAGTGATAAGAAATAACCCAAA
TCTGATAAAAAGAGCAAGAAAGACACTCAGTCTACTAATGCTGATTAATTAGACACAAAC
TAAACAAAGAAATCTTCTCTGAAAAAGAATGCATCAAATGATGAACCTCCCATGAAAAAA
CAAAAAATTACCTTTAACGATATATAAGTAACTAAATCATCCAAGGATGAGGGTGGAATA
GAAGGAGATGAGGTCTATGAAGCTTAGAAAGAAAAGCTAAGAGAAAGAAAAGCAATGAAA
AAGGAATAAAACAAGGAAAAGAAAGTACAAGCACTCCACTAAGTCGACAGAATGGAGAAG
GACATCCAGAGAAACATAAACTACGATATAATGAAGGCAAAAGGTCTCACCCGTAAGAGA
AAGAAGATCGATAGAAACTCCAGAGTTAAATTCAGAGAAAAATACAGAAAAGCACTTATT
AAGAGAGGCAGCAAGGTTCAGGAGTACAAAGAGGGGCCTAAGGGAGTCTATGGGGGAGAG
AAGACTGGTCTTAAACCTGGTCTCATTAAGTCTACATCACTTAATTGA


>Contig152.1.g19(protein)
MPKKQQRNIKPASSDEEDDNDMGSSYDDESGSDLGNNDNREMVVDKKHLLNYESDDSDDD
DNGMGSDSDDFGKELQKQKEDLKMNDTWGSKKKNFYGRDKKGGDDITSSEDDEDERLEAL
RLQKVRAKKLQMMAQQQQQDQDAEVDGKASKKITGLIKSDEDEESEDSEEDFAQRRLKSR
LGDKLFAEDQTNTKSQNSKADNSVNKMKELIKEVQNPKTIKAIIEKENPELLGLLEEFQY
SLDDINTKLKPILDHANSFKKSHKNTLTYIEMKHNLLLSYCTFLSFYLLLKVDGKQVQNH
PVLFKITHIKGLLDNLRPVDEKLEGQLLKMLKQIKKIEKKQQKADAKKKKELPSDVEEYD
EEEEGNQSEIDMDEYDMEDVSDVENEQYEEDGEEDEEDDYDDEEDLEDEMEEMEEDMDDE
YDEEEQDDKYDRDDGVSMNITDLEKLYEFKNGKLVKKAGVVNEFENKEPKTKESDKKQPK
SDKKSKKDTQSTNADQLDTNQTKKSSLKKNASNDEPPMKKQKITFNDIQVTKSSKDEGGI
EGDEVYEAQKEKLRERKAMKKEQNKEKKVQALHQVDRMEKDIQRNINYDIMKAKGLTRKR
KKIDRNSRVKFREKYRKALIKRGSKVQEYKEGPKGVYGGEKTGLKPGLIKSTSLN