Identifiers and Description

Gene Model Identifier

Contig17921.0.g78

Standard Name

NCLc

Aliases

Contig17921_0_g78

Description

RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Domains

  • ( pfam00076 ) RNA recognition motif (a k a RRM, RBD, or RNP domain)
  • ( pfam14259 ) RNA recognition motif (a k a RRM, RBD, or RNP domain)
  • ( pfam13893 ) RNA recognition motif (a k a RRM, RBD, or RNP domain)
  • ( pfam11608 ) Limkain b1

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_000471701.0003292389192957e-45hypothetical protein
SGDYGR159C1.999598840915195e-17NSR1 SGDID:S000003391, Chr VII
from 807656-806412, Geno...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig17921.0.g78(coding)
ATGGGGAAAACCAAGAAATCCTTAAAAAGACAGCAGCCAGACTCACTGACATCCGATGAA
GAAGATGAACAGAAGCAGGATGTGGTGGTTGCATCTGATAGTGAAGAGGAAGTTAAACAA
TCCTCCAAAAAGTAGAATAAAGATAAAAAGGAGAAGAAGGGGAAGAAATAGATCAGTAAG
GAGGATGAGTCTGATTTAAGCAGCTCAGATGATGATAGTGATGATGATAACAAAGGCAGC
ATTTCTAAGCAAGTTTTCATATCTGGAATTCCCTATGAGTGCAATGAAGATGAAATTACT
GAATTCTTCAATGAAATCAAAGCCAACATAGTAGAGATTAAATTGCCAAGATATCAGGAC
AGTGGAAGATGCAGAGGCTACGCTCACGTGACTCTAAATTCCTAAAAAGCAGTTGATAAG
GCATTAGCAATGACTGGTCAGTCAATCAAAGGCAGATACTTAGATATAAAAGAAGCTGAG
GGACAAAGATCTTCACTTTCTAAGGATTAAGTCAGATAAATCGCAGAGAGTATGCCAGAT
GACTGCAAAACCTTATTTGTGAAGGGCCTTCCTTATGAATTCCGTGAGGATGATATTGGT
GATCGTTTCAGAAAATTCGGAGAAATTAAGAGCATCAGATTGTCTTATAACTGGCAGACT
AAGCAGTTTAAGGGCTTCGCATACTTGACTTTTGGTAATCATTAATCAGCTAAAAAGGCT
TTGTTGGAGATGAACGGAAAAGAAGTAAAGGGAAGACAGATTAAAGTTGACTACGATGTG
GTTCAAGAGCCAAAACAAGGTTACAAGGTGAACTTGAATAACGAAAAGAATAAACTTTAT
AATAAGGAGGTTGTGAAGGAAGAACTCAAGAAGAGACACAGAAAAGAAAAGGATAAGACC
GAGAGTTCAAAGCCAAAGAAGAGCATTATTTGA


>Contig17921.0.g78(protein)
MGKTKKSLKRQQPDSLTSDEEDEQKQDVVVASDSEEEVKQSSKKQNKDKKEKKGKKQISK
EDESDLSSSDDDSDDDNKGSISKQVFISGIPYECNEDEITEFFNEIKANIVEIKLPRYQD
SGRCRGYAHVTLNSQKAVDKALAMTGQSIKGRYLDIKEAEGQRSSLSKDQVRQIAESMPD
DCKTLFVKGLPYEFREDDIGDRFRKFGEIKSIRLSYNWQTKQFKGFAYLTFGNHQSAKKA
LLEMNGKEVKGRQIKVDYDVVQEPKQGYKVNLNNEKNKLYNKEVVKEELKKRHRKEKDKT
ESSKPKKSII