Identifiers and Description

Gene Model Identifier

Contig11442.0.g16

Standard Name

NCLb

Aliases

Contig11442_0_g16

Description

RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

  • transcription initiation from RNA polymerase II promoter (IEA) | GO:0006367

Domains

  • ( pfam00076 ) RNA recognition motif (a k a RRM, RBD, or RNP domain)
  • ( pfam14259 ) RNA recognition motif (a k a RRM, RBD, or RNP domain)
  • ( pfam13893 ) RNA recognition motif (a k a RRM, RBD, or RNP domain)
  • ( pfam11608 ) Limkain b1
  • ( pfam03153 ) Transcription factor IIA, alpha/beta subunit

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
SGDYGR159C9.002093297142233e-23NSR1 SGDID:S000003391, Chr VII
from 807656-806412, Geno...
T. thermophilaTTHERM_000471702.0002795641672355e-21hypothetical protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig11442.0.g16(coding)
ATGGCTTGGCACAGTACTCGTACTATGATGTGGAAAAAGGGTAAAGCTCCAGTACAAGTG
AGAAAGTCATCAAATGTCTCCGCTGGTAGCGCCTCTGCTGCTGCTAAACCAGACTCACGC
AGACAATCAATGGATTAAAACAAAACACAATAGAAGCAAGGAACCAAGGCTCAAGTCGTC
CAACAAAAGAAGAGTCAAGGTACCAAGAAAGTCATCCAACCAGAGAGCGAGTCAGATAAT
GACATTGATGGTGAAGACAGCGAGGAAGATTTAATGGCTCAAATTTTGAAGACCCAACAA
GCCAAGAAGGGTGCTGCTGCCACCATCGGCAAGAGATCAAGAGGTAGCTCTAATGTTAGT
GCTGGCAATACCAAGGGCAAGAAACCCGTTTAAGTCGTTGAGCCAGAAAGTGATGAAGAC
GAAGATGAGGACGATGATGAAGACGTTGACGATGAAGAGGATGTTGACGAAGAAGACGGA
GAAGAAGGTAGCGATGACGAAGGTTCCGATGAAGAAGATGATGAGGCTAAGGCTGACAAG
GCAGCTGCTGAGTCAACTGAGATCTTTGTTGGTAACATTCCATTCACCACTGATGCTGAA
ACCTTAAAAGCTAAATTCGAAGCAATTGGAACTATTGTTAATGTTTCCATCCCAATGTCC
GGTAAACGCATGAAGGGTTACGCTTTCATTAAGTTCTCAACCAGAGCCGAAGCTGAGAAA
GCCGTAAAGAAGCTTAATGACTTCGATTTTGACGGTAGATAACTTAAAGTTAACTTCTCA
AGCGGTAAAGAAGCTGAGAAGCGCGAGAAGAAGACTGGTGATGAGAACGGCGAAAAGAAG
GAGTAAACCAAATCAAGCACAGTTTTCATCGGAAACTTGAGCTATTCCACCAACGAGCAA
AACATTAGAAAGCTCTTAAAAGACTGCGGTGAAATTAAGGGTGTTAGAATCGCTCTCGGA
GAAGACGGTAAAATGAAGGGATTCGCTCATGTTGAATTCGAGGATGCCGAATCAGCAGAG
AAAGCCATGAAGTTCAATGGCGCAGACCTCGATGGTAGAAATATCAAGGTCGATATCTCA
GAGAAACTTAGAGATAAGAGAGCCGAAGGTGGAAGCTGGTAAGCTAGAAGAGGCGGCGAT
AGAGGTGGCTTCAGAGGCGGCGACAGAGGCGGCTTCAGAGGTGGCTTCAGAGGAGGTGAC
AGAGGTGGCTTCCGTGGAGGAGATAGAGGTGGCTTCAGAGGCGGCGACAGAGGTGGCTTC
AGAGGCGGTCGCGGTGGATTCCGTGGTGGTGATAGAGGAGGTTTCCGTGGAGGAGACAGA
GGTGGCCGTGGAGGTTTCCGTGGAGGCGATAGAGGTCGCGGTGGCTTCAGAGGAGGCGAC
AGAGGTGGCTTCCGTGGAGGAAGAGGTAGATCATGA


>Contig11442.0.g16(protein)
MAWHSTRTMMWKKGKAPVQVRKSSNVSAGSASAAAKPDSRRQSMDQNKTQQKQGTKAQVV
QQKKSQGTKKVIQPESESDNDIDGEDSEEDLMAQILKTQQAKKGAAATIGKRSRGSSNVS
AGNTKGKKPVQVVEPESDEDEDEDDDEDVDDEEDVDEEDGEEGSDDEGSDEEDDEAKADK
AAAESTEIFVGNIPFTTDAETLKAKFEAIGTIVNVSIPMSGKRMKGYAFIKFSTRAEAEK
AVKKLNDFDFDGRQLKVNFSSGKEAEKREKKTGDENGEKKEQTKSSTVFIGNLSYSTNEQ
NIRKLLKDCGEIKGVRIALGEDGKMKGFAHVEFEDAESAEKAMKFNGADLDGRNIKVDIS
EKLRDKRAEGGSWQARRGGDRGGFRGGDRGGFRGGFRGGDRGGFRGGDRGGFRGGDRGGF
RGGRGGFRGGDRGGFRGGDRGGRGGFRGGDRGRGGFRGGDRGGFRGGRGRS