Identifiers and Description

Gene Model Identifier

Contig14869.0.g41

Standard Name

NAT2d

Aliases

Contig14869_0_g41

Description

Inosine-uridine preferring nucleoside hydrolase

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( pfam01156 ) Inosine-uridine preferring nucleoside hydrolase
  • ( pfam00797 ) N-acetyltransferase

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_006915801.000116773704384e-19Inosine-uridine preferring nuc
leoside hydrola...
SGDYDR400W2.0004286606204839e-16URH1 SGDID:S000002808, Chr IV
from 1271063-1272085, Gen...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig14869.0.g41(coding)
ATGGAAACAAAGTCACTAATAGATAGTTCACCAGTCGTAGATTTAAGTGAAAACAAATTG
GATTTATTAGAAAATGAAGTGGCGCCACACGACCAACTCACCTCAACAATCAATTAAGAT
GAACAAGTTATTGCCCCTCAGAATGCCACTACACAAGATATTAGTTCTGGAATGTTAAAG
AAGAAAAAATTATTTAGCGATATCTTCCAAAGACCAAAGAAAGTTATCATTGACTGCGAT
CCTGGAGCTGACGATGCACATGCTATTGTTCTTGCAATATATTTTGCGAAAGCTCACAAT
GTTCAAATACTCGGTATTACAACTGCAGCTTGCAATCACACTGTTGACTAAGTGACTAAA
AACGCACAAATAATTTTGGAGGTATGCAAGGAGTAAAACATCCTGGTATATAAAGGAGGA
CAGCGAGATGATTTTGAACAGATTGATTACTATTTCGGACCAGATGGATTTGGGAATTTT
GCATCTACTTTCGAAAAACAAAATGGGGAAATTGGTACAAAACATCTCCATTAAGATTCA
GCATAAAAATTCTTGATTGAATCGGTACAATAAAATCCTAATGAAATAACAATAATCTGC
GTCGGTGCTCTTACAAATATCACAAGAGCTATTGCAGAGTATCCGAATTTTAAAAGTCAA
ATCCGTGATATTGTATAAATGGGTGGAACTCACTAAGGCCAAGGCAACGCCCCTAACTGG
TGCTCAGAGTATAATTTCTACATGGACAGCACCTCAGCCAAGATACTGTTAGAATAACTG
GGAGAAAAGATGACTATTGTTTCATACGAGTTATGCTACAATTTCTATCACGCTCTCACT
CAAGTAGAACTAGCAGCTATATTTGATCAAGATAATGAAATCGCAAGGATGGTGAAAGGG
AGCTACAGTGTTTCATGTAAAGCTGAAGGTGGAAAATACCCTATCTATGATCAGATAGCC
ATTGCAATCGCGTTCTAGCCTGAGTTAGTGCTCGCATTTGTTGAGAAATAATGCAGAGTA
GTCGATGACCATCCTGAACTCAGAGGCTTGATGCTGATCAACTGGCTGGATCAAGGAGTT
GATGAGACTGTTCCAAAATCAAGAATTATCACAAAGATAGATAAAGTAGCATTGAAAGAG
TACCTGTAAGATTGTTTGAGCAGTGATTCAGATGTGTGTTAAAAGAGAATAGAGAACAAT
CACCGCAACTAACAGACTTTAATGGCTTATCTAGAGGCTGTGGGCCTGCCTCGCCACCTC
AAGCTGACTCCCTCGGTTGAGACCCTGCACATGGTGGTGAACAGACACGTACTGGCCGTG
CCCTACCAGAACTTCCACTTCCACTTCAAACTCAGGCAGCCACTCTCATTCGACTTCCAC
GACCTCGTGTAGAGAATGGTAGTTTAGGGAGAGGGAGGTTTGTGTTGCGAGCACACAGCT
CTCACATACTATGTTTTAAAGAATTTAGGATTCAATGTAAAATGCATTTTAAGTGCTATT
ACTAAGTTCATTGAAGGGCCTTTTAGAGAAGACTTAGATTTCTGGCACTCCTTGGTCATA
GCAACACTCGATAATTAAGATTACTTAGTAGATACAGGGTATGGAGTTGGAATACCTAAA
TATCCACTTCCAATCTATAAAGATAAATTAGGAGAGACGATCTACGAGTTTAATGATCAT
GAGAAATCTAGACTGACTAATTTTGGGAATTGCATTGAATTTGCTAATTTTGAGGATGGT
GAATTTCATAGAGGTTATGGATTTACCTATCCAAACCCTAAATCTATAGAAATATTAGAT
CTTCATGCTCACTACCAGAAGCTACTGTTTCTTTAATCATATATTCGCATCAGGGATGAG
TTTATTGTAACTTGTAGAAATACACATAGTGGAAGAATATACACAGTATACTTGCCAGTC
TAGAGTGCTATCTAGGGAAAGTTTATCGGCTATATAATGAGCTACAATCATGATGGAAAT
GCGGAATCAGAGAAAAGGCCTTTCGAGAGCTATGAAGAGTACAAAATGGAATAAAAGAAA
TTAATAAAGTTAGATGTACCAGAAATTGATTTTATAAGATAGGAATACATCAAATTTGAT
TGA


>Contig14869.0.g41(protein)
METKSLIDSSPVVDLSENKLDLLENEVAPHDQLTSTINQDEQVIAPQNATTQDISSGMLK
KKKLFSDIFQRPKKVIIDCDPGADDAHAIVLAIYFAKAHNVQILGITTAACNHTVDQVTK
NAQIILEVCKEQNILVYKGGQRDDFEQIDYYFGPDGFGNFASTFEKQNGEIGTKHLHQDS
AQKFLIESVQQNPNEITIICVGALTNITRAIAEYPNFKSQIRDIVQMGGTHQGQGNAPNW
CSEYNFYMDSTSAKILLEQLGEKMTIVSYELCYNFYHALTQVELAAIFDQDNEIARMVKG
SYSVSCKAEGGKYPIYDQIAIAIAFQPELVLAFVEKQCRVVDDHPELRGLMLINWLDQGV
DETVPKSRIITKIDKVALKEYLQDCLSSDSDVCQKRIENNHRNQQTLMAYLEAVGLPRHL
KLTPSVETLHMVVNRHVLAVPYQNFHFHFKLRQPLSFDFHDLVQRMVVQGEGGLCCEHTA
LTYYVLKNLGFNVKCILSAITKFIEGPFREDLDFWHSLVIATLDNQDYLVDTGYGVGIPK
YPLPIYKDKLGETIYEFNDHEKSRLTNFGNCIEFANFEDGEFHRGYGFTYPNPKSIEILD
LHAHYQKLLFLQSYIRIRDEFIVTCRNTHSGRIYTVYLPVQSAIQGKFIGYIMSYNHDGN
AESEKRPFESYEEYKMEQKKLIKLDVPEIDFIRQEYIKFD