Identifiers and Description

Gene Model Identifier

Contig9474.0.1.g17

Standard Name

NAT2c

Aliases

Contig9474_0_1_g17

Description

N-acetyltransferase

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_012225400.00010003404299092957hypothetical protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig9474.0.1.g17(coding)
ATGTCTGAGAGGTTTTCACTTGAAGAACAGACTGAGATATTGAGGGAGATCGTCAGAAAG
CACACTCATCACATACCATTTCAAAATACACATTTACTGCTTAAAGATAAGCCTGTGAAT
GTTATGACTAAAAAGGCTATTTATTATAGAATGATCGCAGATAAATAGGGTGGCTGTTGC
TATGAATAAGCCTCATTACTATATTTTATTATGAAAGACCTTGGCTTTGAGATTTACAGA
GTTTTAGCATATGAAAAAGAAGAATTTAACAAAGATGCGCTTCAGCCACACGCCTTTAAC
ATAGTTAAACTTAGCAAACTAATTCAAAATGATACTGATGCTACAGAGGATATTATGAAA
ACTCAAAGTTAATATTATCTTATAGACTGCGGTTGGGGCTACAATTCTTTTAGTCAACCT
CTGCCCATTAATTTTACTGACCCAGAGTAAATTATCCACTTAGGTAACAATGAGTCATAT
CGCTTGACTTTGAAATCTGATGAGAATTACGCCATTTTAGAATCCTTTATGAATGATAAA
TGGACTCTCTACTATACATTTTCACTTCCCTTTTAAGACGCTTCTCAAGAACTGATTGAA
TAGAACTATTTCCAATTGACTTAAACCGACGAATTTTACCCAGTGAAAGATAAATATTTC
AAAATTGGCTCTCCAGAATTTGAAACAATTCCTACAGAAAATAATACAGACACTTCAAAA
ATCATTCATAAAAGATCTCAATTTTACTTTGAATTAGAGTCACATGAGGGATTTTATAGG
TTATTTGAGAATGGAGAGATAACTCAGAAGGTTCAATATACAGACTATGAAACATTCAAG
AGAGATATAGTGGCTAAATATGGATTTGAAATGCCAAATTTGAAAGAACTTAAAAATCAG
CAAAATGATTAATGA


>Contig9474.0.1.g17(protein)
MSERFSLEEQTEILREIVRKHTHHIPFQNTHLLLKDKPVNVMTKKAIYYRMIADKQGGCC
YEQASLLYFIMKDLGFEIYRVLAYEKEEFNKDALQPHAFNIVKLSKLIQNDTDATEDIMK
TQSQYYLIDCGWGYNSFSQPLPINFTDPEQIIHLGNNESYRLTLKSDENYAILESFMNDK
WTLYYTFSLPFQDASQELIEQNYFQLTQTDEFYPVKDKYFKIGSPEFETIPTENNTDTSK
IIHKRSQFYFELESHEGFYRLFENGEITQKVQYTDYETFKRDIVAKYGFEMPNLKELKNQ
QNDQ