Identifiers and Description

Gene Model Identifier

Contig17614.0.g88

Standard Name

NAT2b

Aliases

Contig17614_0_g88

Description

Inosine-uridine preferring nucleoside hydrolase

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( pfam01156 ) Inosine-uridine preferring nucleoside hydrolase

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_006915808.996157222146379e-27Inosine-uridine preferring nuc
leoside hydrola...
SGDYDR400W2.000769134519826e-18URH1 SGDID:S000002808, Chr IV
from 1271063-1272085, Gen...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig17614.0.g88(coding)
ATGGAAGACAGTAGAAAACTTTAATTTGACTCTTACTTTGACCTGGTCGACAGGAAACTC
GAAGGCTTTACTTTGGACAAGCCAACCAAGATAATCATAGATACAGACCCCGGTGCGGAC
GACGCTCAGGCCATTATTTTGGCAATTCACCTTGCAAAGAAAATGAATGTGGAAATACTT
GGAATAACTGCGATGGCGGGAAACGGCACACTTGAAGATGTAGTGTTAAACGCTTAGCTT
ACTCTCCTAGCTGCAGACGCCCCTGAGATTCCAATTTACAGGGGATAAAGAGACTACTTG
CATCCATATGAATACGAGCACCCTCACTATGGAATGGATGGGTTCGGGGAGTACTCATAA
GAAATGAAGGATATAGCTTCAAACTTAGTAAATGTGTAAGATTAACTTGCTGTGGAATTC
CTCTCTCAAACTGCAGCCAAATATCCTGGTGAAGTCACACTTATTTGCCTCGCTCCATTA
ACGAACATTGCAGTTGTGTTGAAATAAGATCCTTCTTTTGGAAAAAATATAAAAAACATC
GTGCTACTCGGTGGCTCCTACCTGGCCCATGGTAATACAAAATACAATTGCTCAGAATTC
AACTTCTTGAAAGACCCAGAAGCTGCGAGCATAGTTTTTGAATTATGCGATCACATTACT
ATGGTCCCAATCGAAGTTTCAAGGTCTTTTAGGAGACTTCCCTAGGCTTACGTTAGTCAG
GCATTCACTGCAGAAACCAAGAAGGGGCAACTTGTGAATAAATCTTTCTAAATTGCCTAC
AGAAACTCAGGAAATTACTACGAAGTGGTTGATCCATGTGCTATTGCAGTGGCATTCTGC
CCTGAAGTAGTTACAGAGCATTATTAAAAACCATGTTTCATAGAAACAGAGGGGAGGTAT
ACTAGAGGCATGGTGGTGATTGATTGGATTGGGAGAAGCATTGAGAAAAGACATAATACA
AACATAATAGCCTCCATCGACCTACATAAAGTAGTTGATATGCTTATAGAATGTGTTCAA
GAATGA


>Contig17614.0.g88(protein)
MEDSRKLQFDSYFDLVDRKLEGFTLDKPTKIIIDTDPGADDAQAIILAIHLAKKMNVEIL
GITAMAGNGTLEDVVLNAQLTLLAADAPEIPIYRGQRDYLHPYEYEHPHYGMDGFGEYSQ
EMKDIASNLVNVQDQLAVEFLSQTAAKYPGEVTLICLAPLTNIAVVLKQDPSFGKNIKNI
VLLGGSYLAHGNTKYNCSEFNFLKDPEAASIVFELCDHITMVPIEVSRSFRRLPQAYVSQ
AFTAETKKGQLVNKSFQIAYRNSGNYYEVVDPCAIAVAFCPEVVTEHYQKPCFIETEGRY
TRGMVVIDWIGRSIEKRHNTNIIASIDLHKVVDMLIECVQE