Identifiers and Description

Gene Model Identifier

Contig6913.0.g50

Standard Name

NAT2a

Aliases

Contig6913_0_g50

Description

N-acetyltransferase

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( pfam00797 ) N-acetyltransferase
  • ( pfam02668 ) Taurine catabolism dioxygenase TauD, TfdA family
  • ( pfam02338 ) OTU-like cysteine protease

Gene Expression Profile

No expression data available at this time.

Homologs

No Data fetched for Homologs

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig6913.0.g50(coding)
ATGGGAGCTTGCTGCAGTAATTAGACCACTACAATTCACGAAGAAATCTTAGTTGATATC
ACTAGTGAAGAAATCTTCAAAAAGTACTTTGAATTATTGGAATTGACATACGAAGATGGT
CAGGAGATTACCATAGAGTTCATAAATTAAATTGCTAGAAGACATGTTGAAGTTTTCCCT
TATTAAAATGTACACATGCTCATGAATGAAGCTAAGCCACTTGATCTATCCAGGAAAGCT
ATTTACCATAGAATGCTGATAAGATAACTAGGGGGATGCAGCTACGAGCACGTACTCTTA
TTTTCATATGTAATGCAGCAAATCCTGCGTCCATCCTGTCTATTGCGAGTAATGGCATGG
CGTGGATCTCTCCCAGATGACTAACTGGACACCAAACAGCCTACAGATCACTGCCTAGTT
ATCATCAAAGTTGGAGATAATCACGTACTGATAGATTTGGCAAACACCTACAATCAAGTC
TCAACTGCTCTAGTTATTAAAACTTTAAATGAAAAAGAGCAAGTTCATCATGTTTATGAT
CATGAGAAGTATAAGACTGCAATTGTTGCCAACAAGATAGAACTTCACAGAGAAATCGAA
GGAGAATGGAATTTAATGTACACCATCGCCTTTCCACTTCAAAAACTGAAAGATGATGAC
ATAATAAACCAATACAATGCTTTCATGTAACAAACTGGGTCAGTTGAACTGAGAGATAAC
TTGATAATGATTGGCAAGCTCAGTAACGATCACAGCAGAGTGTAATTTCACTTCAACCTC
CAGGAGTAAAAAGGCTTCTACAGATTATTCGGTGAGGAGCAGTTGAAGCAAGATGAGACT
TACAAGAGCTACAATTAGTTCAAGAAGCAAGTTGAAAAGAAATTCGACAGTGCAATCATT
CTACCTGATTTAAGACTCCTTAAAGTGTAAAATTGA


>Contig6913.0.g50(protein)
MGACCSNQTTTIHEEILVDITSEEIFKKYFELLELTYEDGQEITIEFINQIARRHVEVFP
YQNVHMLMNEAKPLDLSRKAIYHRMLIRQLGGCSYEHVLLFSYVMQQILRPSCLLRVMAW
RGSLPDDQLDTKQPTDHCLVIIKVGDNHVLIDLANTYNQVSTALVIKTLNEKEQVHHVYD
HEKYKTAIVANKIELHREIEGEWNLMYTIAFPLQKLKDDDIINQYNAFMQQTGSVELRDN
LIMIGKLSNDHSRVQFHFNLQEQKGFYRLFGEEQLKQDETYKSYNQFKKQVEKKFDSAII
LPDLRLLKVQN