Identifiers and Description

Gene Model Identifier

Contig12222.0.g10

Standard Name

NAT10

Aliases

Contig12222_0_g10

Description

GNAT acetyltransferase 2

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_005185109.997093137033517e-262ATPase, putative
SGDYNL132W9.997093137033517e-262KRE33 SGDID:S000005076, Chr XI
V from 375321-378491, Gen...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig12222.0.g10(coding)
ATGAAAAAGAAAATTGACGAACGCATCCAGACTCTCATTGAAAACTGTGTTAAACTAAAC
CAACGTGGCTTAGTCATCCTTATTGGAGATAGAGGCATTTATCAAATTGTGAACCTCCAT
TAAATGCTTGCTAGAGCTAGAGTAAAGGCTCAGCCATCAGTGTTATGGTGCTACAAGAAA
GAGTTAGAATTCTCATCAAACAAACAAAAGCGTATCAAGCAAGTCAAGAAAATGGAATAG
AAGGGAAACCTAGACAAAGAAGAGATCAATCAGATTGAATTATTCATGTCATCCAAGGAT
ATTAGATACTGCTACTACAAAGACTCCCATAAAATATTGGGTTAAACTTTTGGAATGTGT
GTTATATAAGATTTTGAGAGCATTACTCCCAATGTATTGTGCAGAACAATTGAGACTGTT
GAAGGTGGTGGATTAGTTGTCATGCTATTCAATACTATGACTAGTTTGAAGCAGTTATAT
TCTATTACTATGGATGTTCACTCCAGATATAGAACTGAAGCTCATGGTATGGTCGAGCCA
AGATTCAACGAGAGATTTATTCTTAGTTTAGGATCTTGCCAAACTTGCATCGCTATTGAT
GATGAACTTAACATCTTACCAATTACTTCTCACATCAAGGATATATAGAAAGTCATCTTA
CCTGGTTAAGACTCAAAAGAAGAATCTAAGACTGAGAATCTCTATTTAACTAAAGAGTAA
AAAGACTTGAAAGATCTAAAAGACTAATTGAAATCAACCAAGCCTATTGATACTGTTTCT
GAGAAAAATCTTAAAACAACTATTTCCTTAACAGCAGGCAGAGGAAGAGGTAAATCATCA
GCTCTAGGTATTTCAATTGCAAGTGCTATAGTCTATGGATACAGCAATATTTTTGTTACT
GCACCCACACCAGAGAATTTAGGTAGTGTTTTTGAGTTCGTATTTAGAGGATTAGATGCT
CTTGGGTATAAGGAACATCAAGATTACGAGATTATGTAAAGTACCAATCCTGAATTCAAC
AACGCAGTTGTAAGAGTGAATATTACCAGAGATCATAGACAAACTATTTAATATATCAGA
CCATAAGATCATGCTAAACTGGCTTAAGCAGAATTATTAGTTATCGATGAGGCTGCAGCC
ATCCCAATAACACTTGTCAAGCAACTTCTTGGACCTTACTTGGTATTCTTATCATCAACA
GTAAATGGATATGAAGGCACTGGCAGATCTTTGTCTTTAAAGCTTGTTCATCAATTGAGA
GAATAAAATAGAATGCGAGTATAGAATTAAGGTTATGGTCATTAGCAATAAGCAGCAAAT
TTCAGTGGAGGTAGACAACTCAAAGAAGTGTAGTTAGATGAACCAATCAGATATGGAAAC
AATGATCCCATTGAGAAATGGCTGAATGACCTATTGTGCTTGAAAGCAACTGAGGAAATT
GATAGTCTTAAGAACGGATGCCCACATCCAAATCAATGTGATTTATACTATGTCAACAGA
GACACTCTCTTCTCTTATCATTCATCAAGTGAGAAATTCCTTAAGAAGATTATGTCAATA
TTCGTATCATCTCACTACAAGAATACTCCAAATGACTTACTTCTTTTATCTGATGCCCCA
GCTCATTAAGTATTCGTGCTTCTCGGACCAATCAGCGATTAGGCATCTTCCCTCCCCGAT
ATCTTATGTGCCGTACAAGTGTGCTTTGAGGGTGACATCAGCAAGTAAACTATTTCAGAG
AACTTAAAGAGAGGAATCAGGCCATCAGGTGATTTGATTCCATGGACCATCTCAGAACAG
TATCAAGACGACTCATTCGGATCACTAAATGGCATTAGAATTATCAGAATTGCAACTCAC
CCAAATGCTCAGAATAAGGGCTATGGATCCAGAGCAATTGAGCTTATCATCAAATACTAT
CAACAGCAGCTCACTGATTTTGACAATATTCAGACAAATGAAGCTGAGGAACTTGCAGTC
AAGAAGCCAAAGAATGAAGATTTTAGTTCATCAAAGGGATTAAAAGATGAAAAGCTCAAG
CCTAAGAAAAACCTCAAACCTATTCTACAAAAGCTTTCAGAAAGAAAACCAATGCCAATT
CACTACATCGGTACATCATTCGGATTGACTAAGGAATTGTTCAACTTCTGGAGAAAGAAC
AAATTCGTTCCTCTGTATATGAGGTAAACTGCAAATGACCTCACTGGCGAGCATACTTGC
TTGATGATCAGACCTATAAACACCAAAGACCACAATGTCACTTTACCAGAACAAATTAAG
AAGTATGCTGAGGAAGCAGATACCGATGATTCATGGGCTGCTGCTTATACTATTGATTTC
AGAAAGAGAATGATCAACTTACTTTCATATGAATTTAGTCACCTATCATCTTCATTGGCA
CTATAAATTGTAAACCCATAGATCAAAGCAATCGCTGGTAATGATGAAAATCAAGAAGAT
CAATAAGCTATCAATGCTATCTAAAAGGAAAACTTGGAGATTTATGTGACTCTGTTCGAT
TTGAAGCGTTTAGAATCCTACTCAAAGAATCTCGTTGACTTCCATTTGATTATGGATTTA
GTGCCAACTTTAGCTAAACTTTACTACACCAGATCTTCCAACAACAACTCCACTCCGGCT
AATGTCTTGCCTAAGTCAGCTGTCACTCTATCTTACACTCAGAGTGCTATATTGTTAGGT
ATGGGACTTCAACACAAGAGTGTTGAGGAATTGCAAGTAGACTTAAACCTACAAGCCAAT
CAGTTGCTTCCTCTCTTCAACAAAGGTATCAGAAAGTTTACAAGAGTTTTCAGAGAAGTT
TTTGAAAGAGAGATTGCAAAGCAAGTGGACTATGAAACTCAAAAAGGCCACGAATAATTG
AAAAAGAATCTCAAAGAGTCAACTGGTCAAATAAAGCAGAGTTTAACTGAGGAATTGGAT
GCTAGTGACCACTAATTGACAAAGAAAATGAGACAAGAGAAGGAGGACTTTATTAAGAAG
TTCAAAAAGCACGAAATCAAGCAGACTGATGAAGATTTCAAGAAAGCTACTCATGGCAAA
GGAAACCTCAATATTGTCAGTATTGAGAAGAAAAAGAGGGACAATGAAGAAGATGTGGAA
GATTTAGAGAAAAACGTCAAAAAGAACAAGGACAAGAAAGAGAAGAGACATAAACAATGA


>Contig12222.0.g10(protein)
MKKKIDERIQTLIENCVKLNQRGLVILIGDRGIYQIVNLHQMLARARVKAQPSVLWCYKK
ELEFSSNKQKRIKQVKKMEQKGNLDKEEINQIELFMSSKDIRYCYYKDSHKILGQTFGMC
VIQDFESITPNVLCRTIETVEGGGLVVMLFNTMTSLKQLYSITMDVHSRYRTEAHGMVEP
RFNERFILSLGSCQTCIAIDDELNILPITSHIKDIQKVILPGQDSKEESKTENLYLTKEQ
KDLKDLKDQLKSTKPIDTVSEKNLKTTISLTAGRGRGKSSALGISIASAIVYGYSNIFVT
APTPENLGSVFEFVFRGLDALGYKEHQDYEIMQSTNPEFNNAVVRVNITRDHRQTIQYIR
PQDHAKLAQAELLVIDEAAAIPITLVKQLLGPYLVFLSSTVNGYEGTGRSLSLKLVHQLR
EQNRMRVQNQGYGHQQQAANFSGGRQLKEVQLDEPIRYGNNDPIEKWLNDLLCLKATEEI
DSLKNGCPHPNQCDLYYVNRDTLFSYHSSSEKFLKKIMSIFVSSHYKNTPNDLLLLSDAP
AHQVFVLLGPISDQASSLPDILCAVQVCFEGDISKQTISENLKRGIRPSGDLIPWTISEQ
YQDDSFGSLNGIRIIRIATHPNAQNKGYGSRAIELIIKYYQQQLTDFDNIQTNEAEELAV
KKPKNEDFSSSKGLKDEKLKPKKNLKPILQKLSERKPMPIHYIGTSFGLTKELFNFWRKN
KFVPLYMRQTANDLTGEHTCLMIRPINTKDHNVTLPEQIKKYAEEADTDDSWAAAYTIDF
RKRMINLLSYEFSHLSSSLALQIVNPQIKAIAGNDENQEDQQAINAIQKENLEIYVTLFD
LKRLESYSKNLVDFHLIMDLVPTLAKLYYTRSSNNNSTPANVLPKSAVTLSYTQSAILLG
MGLQHKSVEELQVDLNLQANQLLPLFNKGIRKFTRVFREVFEREIAKQVDYETQKGHEQL
KKNLKESTGQIKQSLTEELDASDHQLTKKMRQEKEDFIKKFKKHEIKQTDEDFKKATHGK
GNLNIVSIEKKKRDNEEDVEDLEKNVKKNKDKKEKRHKQ