Identifiers and Description

Gene Model Identifier

Contig16275.0.g39

Standard Name

NARS2

Aliases

Contig16275_0_g39

Description

tRNA synthetases class II (D, K and N)

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( pfam00152 ) tRNA synthetases class II (D, K and N)
  • ( pfam01336 ) OB-fold nucleic acid binding domain
  • ( pfam01409 ) tRNA synthetases class II core domain (F)

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_006918902.000127961544401e-120asparaginyl-tRNA synthetase fa
mily protein
SGDYCR024C8.998739065740874e-48SLM5 SGDID:S000000618, Chr III
from 162222-160744, Geno...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig16275.0.g39(coding)
ATGGAATCTACTGCAGATACTACACAAGCAACCACTCACTAACAAGAGAACGATGCTTAA
GAACATCAATAAATTGAGAAGCAACCATATCACGATTTAGGAGAGTATGTTTCTGAAGTC
ACCAAGCTTGAGGTTGAGAAGAAGAACGTGCCAGTCTCATCATACGGTCATCGTTTGAGA
ATAGCTAGACTCTATGAAGACCACGAGGAGTTTATGCACAAGATCATTACTGTTGCAGGT
TGGGTTAGAACTAAGAGAGACGGAGGTAAAGACTTCTGCTTCATTGAGCTCACCGATGGA
TCATGCCAAAAGGGACTTCAAGTCGTAGTGTTCAAGGAAATCGATGGTTTCGAGAACATT
TTAAAGACCAATGTAGGCACTAGTTTGAAATTCAAGGGTACACTTATTAGATCACCAGCT
AAGGGATAACTCTTCGAGTTACAACTCAGTTAGGCAGACAGACACACCGCTGAGATCCTT
GGAAACTGCGATGCTGGAAAATATCCACTTGGAGGCAAGAAGAGACATACTGTGGAATAT
TTGAGAGAAATCGCTCACTTGAGACCTAGAACTAACTTGTTTGGAGCAGTCACTAGAGTC
AGAAACAACTTAGCTTACGCCACTCATTTGTTCTTCTAACAAAGAGGTTTCTTGTATATT
CATACTCCAATCATTACTGCCTCAGATTGCGAAGGTGCAGGTCAAATGTTCTAAGTCACA
ACTGTCTTGCCAGAGCCACACGATAACATCTCAAAGATGCCACTCATCGATGGTCTCGAA
GAAGAGAAGAAGGAAGACGTCAAAGCTCAATCAAAGAAGGACAAGAAGAAGGCTGACAAA
GCTGCCAAAAAAGATAAGAAAGCAGCTGGAGATGATGCAAAGAAGGTTGATGGTGCTGAT
CCAGTTAAGACTGATGATCAAACAGCTGAACAATAATAATAAGTGCAACAACCAGTAGTT
GAGGAAGCTAAAGCAGCTATTCCATTCGAAGAGAGAAAAGTTAACTATAAGAAGGATCTG
TTCGGAAAGCCATCTTTCCTGACTGTATCTGGTCAACTCAACGTTGAAAACTATTGCTGT
GCATTGAGTGACGTCTACACTTTCGGACCAACTTTCAGAGCTGAGAACTCCCATACCTCA
CGCCATTTGGCTGAATTCTGGATGATTGAACCAGAACTCGCCTTCGCCACTCTCCCAGAC
AACATGCAATGCGCTGAAGATTATCTTAAGTTCTGTCTCGAATATGTTCTCCTCAACAAC
AAAGAAGAGCTCCTTTTCTTCGACTAATTCGTAGAAAAAGGTCTTATTGAGAGACTTACC
AAGGTCGTCCAAACTCCATTCAAGAGAGTTCAATACACCGAAGGTATTGATATCTTGGAA
GCTCATATCAAGGAGAAGAAAGTCAAGTTCGACAACAAGGTATTCTGGGGTGTTGATCTT
GCTTCAGAGCATGAGAAATATTTGACCGACAAGGTTTTCGAGGGACCAATCATTCTCTAC
AACTATCCTAAGGATATCAAGGCATTCTACATGAAATTGAATGCTGATGGTAAGACTGTC
CAAGCCATGGACGTTCTTGTCCCAAGAATCGGAGAACTTATTGGAGGCTCTGCCAGAGAG
GAGAACCTTGAACTCTTAGACTAAAGAATCCGTGACTGCAAGCTCGAAATCGAAGCTTAC
TGGTGGTACAGACAGTTGAGAGAGTACGGAACTATTCCTCACTGCGGTTTCGGACTTGGA
TTTGAGAGACTCGTCATGATGGCAACTGGTGTTGAAAACATCAGAGATGTCATTCCATTC
CCAAGAGCTCCAGGTACTGCTGAATTCTGA


>Contig16275.0.g39(protein)
MESTADTTQATTHQQENDAQEHQQIEKQPYHDLGEYVSEVTKLEVEKKNVPVSSYGHRLR
IARLYEDHEEFMHKIITVAGWVRTKRDGGKDFCFIELTDGSCQKGLQVVVFKEIDGFENI
LKTNVGTSLKFKGTLIRSPAKGQLFELQLSQADRHTAEILGNCDAGKYPLGGKKRHTVEY
LREIAHLRPRTNLFGAVTRVRNNLAYATHLFFQQRGFLYIHTPIITASDCEGAGQMFQVT
TVLPEPHDNISKMPLIDGLEEEKKEDVKAQSKKDKKKADKAAKKDKKAAGDDAKKVDGAD
PVKTDDQTAEQQQQVQQPVVEEAKAAIPFEERKVNYKKDLFGKPSFLTVSGQLNVENYCC
ALSDVYTFGPTFRAENSHTSRHLAEFWMIEPELAFATLPDNMQCAEDYLKFCLEYVLLNN
KEELLFFDQFVEKGLIERLTKVVQTPFKRVQYTEGIDILEAHIKEKKVKFDNKVFWGVDL
ASEHEKYLTDKVFEGPIILYNYPKDIKAFYMKLNADGKTVQAMDVLVPRIGELIGGSARE
ENLELLDQRIRDCKLEIEAYWWYRQLREYGTIPHCGFGLGFERLVMMATGVENIRDVIPF
PRAPGTAEF