Identifiers and Description

Gene Model Identifier

Contig11754.0.g93

Standard Name

NAF1c

Aliases

Contig11754_0_g93

Description

Gar1/Naf1 RNA binding region

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_003018200.000000000000001999258566166494NAF1 domain containing protein
SGDYNL124W0.0000009995106777214876NAF1 SGDID:S000005068, Chr XIV
from 392892-394370, Geno...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig11754.0.g93(coding)
ATGAGTGATGACGATAGTGAAGATGATAAACCAGGAAACAACACTTCTGATACAAGTTCA
TATATGTCAGATAATGAATCTAGAATGTATGAAGTCGAAGAAACAAAGGAAAAGGCAGTA
CCAGCAGAGGATAAACAGATGGATATGATTGATGAATTCGAAGAGAACACAGTGTCATCT
TATGCTAAATTCAAGACTTAAAATGAAATAGATTTAGAACAGATAGATAAATATGCTCCC
AAAATACCAGAATTAGATGAGCTTGATGACATTCTGGAATTTGGTATTGTCAAGAAATTT
ATTGAGGATGGACAGTCTAATGTGATACTTATTTAGCCACTCAACCCAAATTAAATTTAC
GACTTAGATAACATTGTGTGTTTCAAGAATAAATAAGTAGTCGGTTTTGTTCTAGACTTA
GTGGGACATATCAACCAACCATTGTATACTGTTAGAGTTTACCCATAGTTTATTGAGAAA
CTGCACTCTCAAAATATAGAACCTAAAAATCAACTGATAGATGCCAAAATATACCTAGTA
GCAAAGAGTCTTAAGGTTATCAACGCATAGCTACCTGTGATATTGAGCAAGAAAGGATGT
GATGCTAGTAATATTTATGATGAGGAGCTAGCTGAACATGAAAGGGAGTTTTCAGATGAT
GAAAAGGAAAGAGAAGCCAAGAAAGCAAGAAAAAATAAGAAAAAGCTGAAGTAACAGTAA
TAGTAAAACAGCAATAGAGTAATGGAAGAAGGTGAAATTGAAGAGGAAGAAGATTAGATA
CTATAGAAGAGAAAGTTTAACCAATCTCATCACCAAAACCATCACGATAATAAACACAAG
GGAGGACAGCATTAGAATAATGATTTCAAGCATAAGAAGAGATTTAATGAGGATTTCAGA
TAGAATTAAGGTCAGTAAATACCAATGTACTCTACTAATTTCGCAGTAAACTAGCAATAA
AACGTTCCATAGATGCAGCAACCTGCTGCCAATCCTATGCAAAATAACATGATGATGTAT
TAATAGTAATTTAACAACATGTATGGTTAGCAGCAGCAATATCCTTAAAATGCATTTGGC
ATGGCTTAAGCATTTCAATAGTCAAAGACTTAGTTTATATGGAAATTCAGCTTGGACTCT
TAGATGGTGACAATTGAGTTGATTTGCAGTCATCTGAGTGGGAAGAAGAAAGTATTCAGA
GATGGAAGAGTGATATTTGAAACATAGAAGTTTGGGACTTCTTTCCAGTATCCATTCCAA
ATAAACAATCACATGCTCAACATCATCCAACATGGAGATCACTTTGAACTCAGAATTGAT
AACCAAAGTTTTCAGCATTTGTATCATCAAGACAAGACAAGGAGGGAATTCAGGTATGAT
GATGAAGATAAGTAAGACCAAGACTACTCAAAGTCTAACAGTAATGCAAATCAAGGAATC
GGATCATCAACTGCAAATAATGATAATGGGTTTAACTTCGATAAATATGAAAATTATGAT
GGAAACAAGAATAATGGGATAGGCAGTACCAATCAAGATTATGGGTATGGTGGTTATAAG
AAGGGACATGGTGAAGTGCAGTGGGGTAATAATTCTAATTAATCGAATTAGAGAAGTAAA
CCCAATGATTCTTACAGTCCTGATAGATCTAACAATCAGCCAGCAAAGGGAGGTACTTTC
TTTGAGTAATTTGGATAATAACCAGCAATAAAGAAAGCTGAATATATCGGTAAATAAAAG
AACACAGACAATTTATTGGAAATGGGGGGAAGCATCAATCAATCATAAAAACAGCAATCA
GCAAATTCAAACTTCTTCGACTTTGATTTTAATGCAAATGCTAATTCTAATTAGTAATAA
TAACCATAACAATAGCAATAACAAGTGGCATAAGCAGGGTTTGATTTTGATTTTAATTCT
TCAAACTAATCCAAAGCGTTTGACTTCAATTCATTTGGCAATCAATAACAGTAAACCCAA
CCCATCTAATCTAATAAAAGTTAAAACCAGTAAAATTTGATAGAGTCACTATTTGATCAG
CCTGCTCCTTAGAAAAGTTTAGATGATTTGCTAGGCGGTTCCAATCATATTCCAGGAGCT
CTGCCATAACTCAATCAACCTCAAAATTAAGGATTAAATATCGAAGAACAATAAAAGATT
CAATAGCTACTCACAACTGGATACTCAAATATCAACTCTAATCAAGCCCCTTCATAGTTT
GTTCCTAATCCCTTAAGTGGTTTTGGTTCTTAAGTGAATTAACAGTAAAATCCATAGCCT
CAAATGAACTAACAATTCAGTGGACTAGGTTTCAATCAGGTAAATGACAAAGAAAACTTA
GAGAAAAAGCTAGTAAACTTAGACAACTTAGGCAGTGGATTAGTGAACCAATAAACAAGC
TAAGTAAGATCTAATGCTGACCCATTTGCAGATGCCTTTAACAATAATTAAAAGACTGTA
ATACCCTAAAATAATCAAAAAGATGCCTTTAGTTTTGTGTAGAATTAGCTTTCTGCTGAT
TAGTAGCATTAACAACAGTAGTAAAATAATATGATCTAGCAATAAATAGGATTATAAAAT
CCAGCTTAAGTTCAAGTGAATGTACCTCAGCAATAATAACAACAACCAGGAAATGATTTC
TTCTTCGGGTTTTAGGAAAACACTCAAAATTAGCAAGCTTCTCAGTAAACTAATGCAAAT
TTCAATTTCTTCTGA


>Contig11754.0.g93(protein)
MSDDDSEDDKPGNNTSDTSSYMSDNESRMYEVEETKEKAVPAEDKQMDMIDEFEENTVSS
YAKFKTQNEIDLEQIDKYAPKIPELDELDDILEFGIVKKFIEDGQSNVILIQPLNPNQIY
DLDNIVCFKNKQVVGFVLDLVGHINQPLYTVRVYPQFIEKLHSQNIEPKNQLIDAKIYLV
AKSLKVINAQLPVILSKKGCDASNIYDEELAEHEREFSDDEKEREAKKARKNKKKLKQQQ
QQNSNRVMEEGEIEEEEDQILQKRKFNQSHHQNHHDNKHKGGQHQNNDFKHKKRFNEDFR
QNQGQQIPMYSTNFAVNQQQNVPQMQQPAANPMQNNMMMYQQQFNNMYGQQQQYPQNAFG
MAQAFQQSKTQFIWKFSLDSQMVTIELICSHLSGKKKVFRDGRVIFETQKFGTSFQYPFQ
INNHMLNIIQHGDHFELRIDNQSFQHLYHQDKTRREFRYDDEDKQDQDYSKSNSNANQGI
GSSTANNDNGFNFDKYENYDGNKNNGIGSTNQDYGYGGYKKGHGEVQWGNNSNQSNQRSK
PNDSYSPDRSNNQPAKGGTFFEQFGQQPAIKKAEYIGKQKNTDNLLEMGGSINQSQKQQS
ANSNFFDFDFNANANSNQQQQPQQQQQQVAQAGFDFDFNSSNQSKAFDFNSFGNQQQQTQ
PIQSNKSQNQQNLIESLFDQPAPQKSLDDLLGGSNHIPGALPQLNQPQNQGLNIEEQQKI
QQLLTTGYSNINSNQAPSQFVPNPLSGFGSQVNQQQNPQPQMNQQFSGLGFNQVNDKENL
EKKLVNLDNLGSGLVNQQTSQVRSNADPFADAFNNNQKTVIPQNNQKDAFSFVQNQLSAD
QQHQQQQQNNMIQQQIGLQNPAQVQVNVPQQQQQQPGNDFFFGFQENTQNQQASQQTNAN
FNFF