Identifiers and Description

Gene Model Identifier

Contig4553.0.g55

Standard Name

NAF1b

Aliases

Contig4553_0_g55

Description

hypothetical protein

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

No Data fetched for Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_005816102.999758165421992e-18RE04347p, putative

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig4553.0.g55(coding)
ATGTCAATCACTCCTTAATATTTCGAAATAAAAGATGTCGGTAAAACCATCAAATCTACT
AAGAAGCAGTACGTATGGAGATTCATTCTAGACGGCAAAAACTACACAATAGAGATGTTC
ACAAGTGTGCTCTCAGGAAAGAAGAAAATACTCTAAAATGGATAAATTATTTACTTCGAT
TCAAAGTTCAAGTCTGCCTTTCAGTTCCCCTTCTCCATTGGCAAGAATTCATTGAACATC
TTGCAGCATGGCGATAAGTTCGAGTTGAGAATTAACAATCAATCATTCACTCATCTTTGG
GATAATGAGAGAACAAAGAGAAATTTCAACTATGAAGAGAGAGACTAGATTAATTCCTAT
CAAGCTAAAGACTATGCTAAAAATTATGATCAATCTGTGCCTACGTCAAGTACAAATCAC
AGAAGCAACGACTTAGCTGTGTAACCAAAGCCAAGACATCAGTCTTAACATCACAGCAGA
AGCTCCCACTAGCAATAGTCTTCCAATGTGGATGATTTGACAGGACTAGATTAAACTGAA
ATCCAGGCTTAAATCTAAGCTTACGAAGAACTTTAAAGAAAGCACAAACGTGACCTTGAG
AAGAAAACTCAACAGTAAAATTCCCAATCGCAACAATCTAACCTACAAAGAGTGAGAGAG
TCAGGAAGCAACCAAAACAATAAAGATGTCAAGTACAACGCTTATGATTTTACTACAGGT
TTCGATCATGGCTTTGATAAGTTCTCCACTAATGTCCAGGCTAGTGGAAGTGTAAGCAGC
TAATCCAAACCTTCACAAAAAGCCACTAACAGTGCACAGCAAAAAAGAGAAGAGAGTAAT
GATTTCGATTTCAATTTTGGAAACTAACCTCAATAAAACCCACCCAAATAATAAATTTAA
ACTCAGTAGAAATCTATGCCACCTCAACAACAGGTAGTGAATAATGCTTCAAGTGGAAGT
GCAGGAGGAGACTTATTTGACTTGTTGGGCACATCCACAACGAATGCAAATATGCTGTCC
TAGCCATAGGCTGAAACCAGCAAGAATGCATTGGACTTCTTCAATGATTTAGACTTTGGT
GCTCCTCAACAAAACAACAATAGCTCTGCTTAAATGAACACAGTAGTACACAACCAACCT
GCTGGCAGTGGTAACCTCGATGACATGCTTAGCTTTGGCTCCCCACCCCAAACAAACATC
CAACAGTAACCAGCTTAAACTGGCTTCGGCTTAGATGCATTCGGTGGTCAATAGTAATAG
GTACAGTAACAACAATAGCCAATATAGCAATAACAAGAACCAGTGTAAGATAACAAACCT
AAATTTATGCCAAATCTTGCTGGCTTCTACACTCAATAACAAAACCCAGTGATGAACCAG
TAGGAGATGATGATGCAGCAATAAATGTAGCAGTAAATGATGATGCAGTAGATGATGATG
AACCAATTTGGAACAGCCATGAATTTAGGTGGTGCTGGAGCAGGTCAAGGTATGGGAATG
AATACTGGAGCAAATGCTGGTGGAGCTATGAATATGGGAGGCATGGGAATGGGAGGTGCC
AACCAATTCAACACTGGCATGCCTGCTTAGAGCTCTGGCATGGGAGGTCTCGGTGGTGGA
TGGGACAACAATTAAAACTAAAGCTATGGAGGCATGGGAGGTGGCTAATAGAATCAATAT
ATGACTGGCATGCCTCAAAACAATAATAATTTCGGTGGCTAATAGCCATTCGGAGGCCAG
CAATAATAATAATAGCAAAACTCCTATTAAACTTCTATTCCTCAACAGAACAACTACGGA
GGTGGAATGGCAATGGGAGCTGGAGTGAGTGGTGGCGCTGGTGCTGCTTCAACTCCCTTC
GATCTCTTCAATTGA


>Contig4553.0.g55(protein)
MSITPQYFEIKDVGKTIKSTKKQYVWRFILDGKNYTIEMFTSVLSGKKKILQNGQIIYFD
SKFKSAFQFPFSIGKNSLNILQHGDKFELRINNQSFTHLWDNERTKRNFNYEERDQINSY
QAKDYAKNYDQSVPTSSTNHRSNDLAVQPKPRHQSQHHSRSSHQQQSSNVDDLTGLDQTE
IQAQIQAYEELQRKHKRDLEKKTQQQNSQSQQSNLQRVRESGSNQNNKDVKYNAYDFTTG
FDHGFDKFSTNVQASGSVSSQSKPSQKATNSAQQKREESNDFDFNFGNQPQQNPPKQQIQ
TQQKSMPPQQQVVNNASSGSAGGDLFDLLGTSTTNANMLSQPQAETSKNALDFFNDLDFG
APQQNNNSSAQMNTVVHNQPAGSGNLDDMLSFGSPPQTNIQQQPAQTGFGLDAFGGQQQQ
VQQQQQPIQQQQEPVQDNKPKFMPNLAGFYTQQQNPVMNQQEMMMQQQMQQQMMMQQMMM
NQFGTAMNLGGAGAGQGMGMNTGANAGGAMNMGGMGMGGANQFNTGMPAQSSGMGGLGGG
WDNNQNQSYGGMGGGQQNQYMTGMPQNNNNFGGQQPFGGQQQQQQQNSYQTSIPQQNNYG
GGMAMGAGVSGGAGAASTPFDLFN