Identifiers and Description

Gene Model Identifier

Contig2768.0.g69

Standard Name

NAF1a

Aliases

Contig2768_0_g69

Description

hypothetical protein

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

No Data fetched for Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_005816102.999758165421992e-18RE04347p, putative

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig2768.0.g69(coding)
ATGTCAATCACTCCTTAATATTTCGAAATAAAAGATGTCGGTAAAACCATCAAATCTACT
AAGAAGCAGTACGTATGGAGATTCATTCTAGACGGCAAAAACTACACAATAGAGATGTTC
ACAAGTGTGCTCTCAGGAAAGAAGAAAATACTCTAAAATGGATAAATTATTTACTTCGAT
TCAAAGTTCAAGTCTGCCTTTCAGTTCCCCTTCTCCATTGGCAAGAATTCATTGAACATC
TTGCAGCATGGCGATAAGTTCGAGTTGAGAATTAACAATCAATCATTCACTCATCTTTGG
GATAATGAGAGAACAAAGAGAAACTTCAACTATGAAGAGAGGGACTAGATTAATTCCTAC
CAAGCTAAAGACTATGCTAAAAATTATGATCAATCTGTGCCTACGTCAAGTACACAACAC
AGAAGCAACGACTTAACTGTGTAACCAAAGCCAAGACATCAATCGTAACACCACAGCAGA
AGCTCCCACCAACAATAGTCTTCCAATGTGGATGATTTGACAGGACTAGATTAAACTGAA
ATCCAGGCTCAAATCTAAGCTTACGAAGAACTTTAAAGAAAGCACAAACGCGACCTTGAA
AAGAAAACTCAATAGCAAAATTCTCAATAGTAGCAATCTAATTTACAAAGAGTGAGAGAG
TCAGGAAGCAACTAAAACAACAAAGATGTTAAGTACAACGCTTATGATTTTACAACAGGT
TTTGATCATGGCTTTGATAAGTTCTCCACTAATGTCCAGGCTAGTGGAAGTGTAAGCAGC
TAATCCAAACCTTCTCAAAAAGCTACAAACAGTGCTCAACAAAAGAGAGAAGAGAGTAAT
GATTTCGATTTCAATTTTGGAAACTAACCATAATAAAACCCACCCAAATAATAAATTTAA
ACTCAGTAGAAGTCTATGCCACCTCAACAACAGGTAGTGAATAATGCTTCAAGTGGAAGT
GCAGGAGGAGACTTATTTGACTTGTTGGGAACATCCACTACTAATACTAATATGCTTTCC
TAGCCATAGGCTGAAACTAGCAAGAATGCATTGGACTTTTTCAATGATTTAGACTTTGGA
GCTCCTCAACAAAACAACAATAGCTCTGCTTAAATGAATACAGTAGTGCACAACCAACCA
GCTGCCAGTGGTAACCTCGATGACATGCTTAGCTTTGGATCTCCACCCCAAACTAACATC
CAGCAGTAACCACCTCAAACTGGCTTTGGCTTAGATCCATTTGGCGGTCAATAGTAATAA
CAGCAATAACAATAACAATAGCAAATATAGCCATAATAGCAATAACAAGAACTAGTGTAA
GATAACAAGCCTAAATTTGTGCCAAACCTGGCTGGTTTCTACACCTAATAACAAAACCCA
GTGATGAACCAGTAGGAAATGATGATGCAGCAATAAATGTAGCAGTAAATGATGATGCAA
TAGATGATGATGAATCAGTTTGGAACTGCCATGAATTTAGGTGGTGCTGGAGCAGGTGCA
GGTATGGGAATGAATACTGGAGCAGGTGCTGGTGGAGCTATGAATATGGGAGGCATGGGA
ATGGGCGGTGCCAACCAATTCAACACTGGCATGCCTGCTTAGAGCTCTGGCATGGGAGGT
CTCGGTGGTGGCTGGGACAACAATTAAAACTAAGCCTACGGAGGCATGGGAGGTGGCTAA
TAGAATCAATATATGACTGGCATGCCTCAAAACAATAATAATTTCGGTGGCTAATAGCCA
TTCGGAGGCCAGCAATAATAATAATAGCAAAACTCCTATTAAACTTCTATTCCTCAACAG
AACAACTACGGAGGTGGAATGGCAATGGGAGCTGGAGTGAGTGGTGGCGCTGGTGCTGCT
TCAACTCCCTTCGATCTCTTCAATTGA


>Contig2768.0.g69(protein)
MSITPQYFEIKDVGKTIKSTKKQYVWRFILDGKNYTIEMFTSVLSGKKKILQNGQIIYFD
SKFKSAFQFPFSIGKNSLNILQHGDKFELRINNQSFTHLWDNERTKRNFNYEERDQINSY
QAKDYAKNYDQSVPTSSTQHRSNDLTVQPKPRHQSQHHSRSSHQQQSSNVDDLTGLDQTE
IQAQIQAYEELQRKHKRDLEKKTQQQNSQQQQSNLQRVRESGSNQNNKDVKYNAYDFTTG
FDHGFDKFSTNVQASGSVSSQSKPSQKATNSAQQKREESNDFDFNFGNQPQQNPPKQQIQ
TQQKSMPPQQQVVNNASSGSAGGDLFDLLGTSTTNTNMLSQPQAETSKNALDFFNDLDFG
APQQNNNSSAQMNTVVHNQPAASGNLDDMLSFGSPPQTNIQQQPPQTGFGLDPFGGQQQQ
QQQQQQQQIQPQQQQQELVQDNKPKFVPNLAGFYTQQQNPVMNQQEMMMQQQMQQQMMMQ
QMMMNQFGTAMNLGGAGAGAGMGMNTGAGAGGAMNMGGMGMGGANQFNTGMPAQSSGMGG
LGGGWDNNQNQAYGGMGGGQQNQYMTGMPQNNNNFGGQQPFGGQQQQQQQNSYQTSIPQQ
NNYGGGMAMGAGVSGGAGAASTPFDLFN