Identifiers and Description

Gene Model Identifier

Contig15448.0.g93

Standard Name

NADK2c

Aliases

Contig15448_0_g93

Description

ATP-NAD kinase

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

No Data fetched for Homologs

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig15448.0.g93(coding)
ATGGTTGTGGAGACATTTTACAACTAATTCAAGAAAATTGGCACAAATATGACAATTAAA
AAAGAAAATGATGTTACTAAGCAAGACTTTTTAGAAAAAGATTTGTGCATTTCAATAGGA
GGAGATAGCGTGTATTTGAGAACTGCAGGATTCATCGATAATCCTGATTTACCCTTACTT
GGAATCGATAGTGATGAAAGCAGGAATAGCGAAGCATTATGCAATGCTTCAATCAAAGTA
GAGGACAGAGACTAAAGAGTAAACCAAATAATAAATAGCTTATAAAAATCGAACTTCTCA
ACTTTCTTGAGAAGCAGAGCAAAGTTTACAACTGAAAACCCTAAAAACAAGTAAACTACA
AAGAAGCTGATTCTTAATGAGGCCTTTATTGCTGACTAGGATGTAACAAGACCGAGTGAT
TATCGTGCCTATGTTGATAATAGAGATATGGGCAAATTTAAAAGTAGTGGAATGATTATA
TCTACAGGCACAGGGTCAGGAGGTTGGCTGCTTTCTTCTAGAAGACTAACACCAAGAAAA
GTTAACTCTGTACTAGAAATAATGGGTGTTGAAGATAGATCTTAAGCCGTTGTTGAATAC
CTAGCTGCCTAATTGAATTGCAGCCTTGTTTTTCCCTGTGACTCAGATCAGCAATATTAT
TATGTGAGAGAGGGATATATCGCTCACGACAACTCATTTTCTTGGAGATCAGAGGGATAC
TGCAAAGAAATCAGGGTTATAAGCGAAATCATAGAAGGGCGTGTTTTAATTGACGGCTAC
TACAATTATGAATTAGAGATAGGATAACAATTTACAATCAAGTCTGCTCCTGAAAATTCA
TTAAAGTGCATATAATTACATATATGA


>Contig15448.0.g93(protein)
MVVETFYNQFKKIGTNMTIKKENDVTKQDFLEKDLCISIGGDSVYLRTAGFIDNPDLPLL
GIDSDESRNSEALCNASIKVEDRDQRVNQIINSLQKSNFSTFLRSRAKFTTENPKNKQTT
KKLILNEAFIADQDVTRPSDYRAYVDNRDMGKFKSSGMIISTGTGSGGWLLSSRRLTPRK
VNSVLEIMGVEDRSQAVVEYLAAQLNCSLVFPCDSDQQYYYVREGYIAHDNSFSWRSEGY
CKEIRVISEIIEGRVLIDGYYNYELEIGQQFTIKSAPENSLKCIQLHI