Identifiers and Description

Gene Model Identifier

Contig22852.0.g19

Standard Name

NADK2b

Aliases

Contig22852_0_g19

Description

ATP-NAD kinase

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
SGDYEL041W0.00010003404299092957YEF1 SGDID:S000000767, Chr V f
rom 75944-77431, Genome R...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig22852.0.g19(coding)
ATGAAAGCATTTTAAAATGTCTTGATTGTGAGTAAAACAACTCGACTAGAACGCCTAATA
AGATAGGGGATACACTTTACTCCCTATATTGAACAGTTCTACAAAAAGGATTGGGAGACT
GCAAATGACATCCATCACTAAGTTATCGAATCATTTTATAAATGGGTACAAAAAATGGGA
ATGAATGCAGTCATAAAAAAGGAAAACGATTTGCAAGTAGAAGACATACACGATAAGGAT
CTGTGCATATCTATTGGTGGGGATAGTACATATTTAAAGGCAGCAGGCATTATTGAAGAT
TCAACGAAACCACTTTTAGGTATTAATAGTGATCCAACCAGAAGAACTGGTGCTCTATGC
AATGAGTCACTTAATTTTAATGAGAGAGAAAAGCAAATTCCAAAAATTATAGAGCAATTG
CAGACTGGTGATTATACTACTTTTCTGAGAAGTAGAGCTCTATTCAACTTTGAGAATCCA
GTGTCTGGTGTATCAACTACTAGATTATGTTTAAATGAGGTGTTTGCAGCTGAGAAGGAT
GTATCTTGCACAAGCATGTATAGAATAAGTGTAGATGGGCGAGATATGGGTAAATTTAAA
AGCAGTGGAATAATTATTGGAACTGGCACTGGTTCATCAGGTTGGTTGTATTCAGCTCGC
TAGATAACCCAGATGGATGTATCTACAATTAACGACATAATTGGGAATTAATAGTCAGAT
GCTGCGCTTAGTAATAACTTATCAGGACTCATGAGTAGCTCAAATGTATTCCCATATGAT
TAAGATGAATTGTACTATTTCGTAAGAGAAGGATATGTATTTGATCCAGCTTCTTATGCC
TGGCGTGCTGAAGGATTTTGCAAATAAATCAAAGTAATTAGCGAGATAATAGATGGGAGT
GTATAAATTGATGGGTATTGGAAAATGGACATTGGCATTGGTGATGTATTCACAGTCACA
GCATGCCCTAATTAAAAATTGAAGTGTCTCATTCTAAACAATGCAAAATCTTCGGAAGGA
TAATGA


>Contig22852.0.g19(protein)
MKAFQNVLIVSKTTRLERLIRQGIHFTPYIEQFYKKDWETANDIHHQVIESFYKWVQKMG
MNAVIKKENDLQVEDIHDKDLCISIGGDSTYLKAAGIIEDSTKPLLGINSDPTRRTGALC
NESLNFNEREKQIPKIIEQLQTGDYTTFLRSRALFNFENPVSGVSTTRLCLNEVFAAEKD
VSCTSMYRISVDGRDMGKFKSSGIIIGTGTGSSGWLYSARQITQMDVSTINDIIGNQQSD
AALSNNLSGLMSSSNVFPYDQDELYYFVREGYVFDPASYAWRAEGFCKQIKVISEIIDGS
VQIDGYWKMDIGIGDVFTVTACPNQKLKCLILNNAKSSEGQ