Identifiers and Description

Gene Model Identifier

Contig14685.0.g28

Standard Name

NADK2a

Aliases

Contig14685_0_g28

Description

ATP-NAD kinase

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( pfam01513 ) ATP-NAD kinase
  • ( pfam09713 ) Plant protein 1589 of unknown function (A thal 3526)

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_000134700.000004000864880866421ATP-NAD kinase family protein
SGDYPL188W0.000005998506718272351POS5 SGDID:S000006109, Chr XVI
from 191406-192650, Geno...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig14685.0.g28(coding)
ATGAAGCAGTCTGGTCGCTAGTTCAGTCCCTACATAGAGAATGTGCTCATGAAAGTATGG
GAAGAGGCAGCAAATGTTCACATGTCGATTGCAGATTTCTGTTATGAGTCATTGAGAAAA
ATGGGCAAGGATGTAACATTAAAAAAGGATTTAGAACTTAAACCAGAGGATATTAACGGC
TAAGATATTCTAATGTCACTTGGGGGCGATGGAACATACTTAAGAACTTCAGGTTTAATT
GAGACACCTGACATTCCAATTTTGGGTATTAATACAGACCCTTCGCGTTCAATAGGTTTC
TTGTGCAATAACAAAATATATGCGGATATGAAAGAGAAGCAAATAGAGAGAATTTTTGAT
AATCTAGAAAAAGAGAATTTTGAGTACTTTTACAGATAGAGAATCAATTTTCAAATGACT
AGTCCTGTCACTGGGGAAGTCACAAATAAATTGGTTTTAAATGAGATATTTGCGGCTGAA
AAAGATACTGGCAAAACGAGTATATATAAATTGATAGTGGATGATTAGGACCTTGGAAAA
TATAAATCAAGTGGTATAATAATCTCTACTGGAACTGGTTCCTCAGGGTGGCTGTTCTCT
GCAAGGAGAATAACTTAGAGTGATGTAAGAACTATCCTGAGTTACATGGGAAACACAGAG
GGAATGGATATGATGGAAGAGCATTATGCAAGGACGATTTCGAAATAGACTATTTTCCCT
CCTGAGGAAGAGCGCATGTATTACTTCGTAAGAGAAGGATACCTGAAAGAAAGAACAGGT
TTCAACAGGCACTCTGAGGGCTACGCAAGCAATATAAAGTACATCAGTGAGCTGATAGAA
GGGCGTGTTTTCATCGATGGCTACTACACCAAAGATATCGGTCTTGGAGACGTCTTTACA
GTAGACACTAAGCCTGAATACAAACTCAAATGTATCAGATTTTTACTCTGA


>Contig14685.0.g28(protein)
MKQSGRQFSPYIENVLMKVWEEAANVHMSIADFCYESLRKMGKDVTLKKDLELKPEDING
QDILMSLGGDGTYLRTSGLIETPDIPILGINTDPSRSIGFLCNNKIYADMKEKQIERIFD
NLEKENFEYFYRQRINFQMTSPVTGEVTNKLVLNEIFAAEKDTGKTSIYKLIVDDQDLGK
YKSSGIIISTGTGSSGWLFSARRITQSDVRTILSYMGNTEGMDMMEEHYARTISKQTIFP
PEEERMYYFVREGYLKERTGFNRHSEGYASNIKYISELIEGRVFIDGYYTKDIGLGDVFT
VDTKPEYKLKCIRFLL