Identifiers and Description

Gene Model Identifier

Contig4906.0.g61

Standard Name

NABE1e

Aliases

Contig4906_0_g61

Description

S1/P1 Nuclease

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_000881200.000000000003001226732525078S1/P1 Nuclease

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig4906.0.g61(coding)
ATGAACACTGCTACAAAAAAGATACAAGGCATATCTGCTTTATTGTTAACTCTATTTATA
AGTTAGACCCTTTGTTGGAAATCTCAAGGTCATTATATAATATCGAGAATAGCTTATGAT
ATTCTATAAAAAGATGCCCCATAAGCTCTACAAAGTGCAACAAGTATGTTAAATGTACTT
AGAATAGCAAATCCAAACCTCACAGATGCAGAGTAAAACTACACTTTTGTAGAGAGTTCT
TCATTTGCTGATTTGATCAAATACAACGGAGGGGCGTTTCAAAGCGACTGGCATTTTGTT
AATATTCCATTTGTCGATCAGCCAAACAAAACTTTGAGTAATTACCCTCTCTTTAGGGTA
AGAAAAGAAAATGTTACAGAGGCCATTATTGGACTTGTTTATTGGCTTTAAAATAAAGAG
GGGTATCAGAATCATTTCGTCTATCTCGATATCATGAAAAAGGTCACCAATGAGCAAGAA
GGAAAATCTTATGCTCTCAGACTGCTAATACATTTTATGGGAGATGTCCACCAGCCTTTA
CATTCTATTGCAAGAATTAATGATTAAAATCCTTCAGAGACGCTGCCATATACTGATAAA
CTGTGGAATACACTTGGGAATACTACAAATACTTTGAGAACAAAATGGAATATTACATGC
TCGGACTATGAAAATAATGATGTTAATTAGTGGGCTAAGGATTCTTATGAGCTTGCTAAG
TTAGCTTATCAAGGAGCAACTGAAAACTTAACACTAAGCGCTGATTACATTTCCAGAAAT
AACCCGATCACTCAACGTTAGATGGTGCTAGCAGGTTTAAGACTTGCACATTTGATAAAA
ATTACATTCGAAACTTCCACTTAGATTCTAGCCTAAACTTTATAATCTTCAGATAACATT
AGAATTCAACTCAAGGCTTAAAATTCTATCAGCGATTAATATGGTTACGACAATTCAAAA
TTTGATATGGAGAGTGGGGAACTGACTGGATTAAGCGCTTGGGATTTCAATTGTAATAGT
AAAGTTAGCAATAACTATTTTCCTTAAATTGAATAGAAATCTTCTGGCTTTTTGAAATGA


>Contig4906.0.g61(protein)
MNTATKKIQGISALLLTLFISQTLCWKSQGHYIISRIAYDILQKDAPQALQSATSMLNVL
RIANPNLTDAEQNYTFVESSSFADLIKYNGGAFQSDWHFVNIPFVDQPNKTLSNYPLFRV
RKENVTEAIIGLVYWLQNKEGYQNHFVYLDIMKKVTNEQEGKSYALRLLIHFMGDVHQPL
HSIARINDQNPSETLPYTDKLWNTLGNTTNTLRTKWNITCSDYENNDVNQWAKDSYELAK
LAYQGATENLTLSADYISRNNPITQRQMVLAGLRLAHLIKITFETSTQILAQTLQSSDNI
RIQLKAQNSISDQYGYDNSKFDMESGELTGLSAWDFNCNSKVSNNYFPQIEQKSSGFLK