Identifiers and Description

Gene Model Identifier

Contig21164.0.g44

Standard Name

NABE1a

Aliases

Contig21164_0_g44

Description

S1/P1 Nuclease

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_000881202.0009605191578312e-25S1/P1 Nuclease

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig21164.0.g44(coding)
ATGAAGTACCAAATCCTCTCAACCCTACTACTCGCYCTACTCACCAGCAGAGCCACCGCC
TTCTGGCAACAAGGCCACTTGATGGTCGCAAGAGTTGCTTACAACCACTTGCAATCAGAA
GCTCCAGAGGCTCTTAAGGCAGCAAATGACATGCTCGCAGTCTACTCAAAGTCAAACCCA
TCCATGACCAAGCTTGAAGGTGACTACCCATTCGTCGAATGCGCCACTTTCGCTGATGAA
ATCAAGGCCAAGGGAGGAGCTTTCCAATCAGGATGGCATTTCATTGATACCCCCTATCTC
GATCAGGGCGGTTCAATCAGCGACTATCCTCAATTCAAATTCGATGAGAATCACATTGGA
AAAGTTATCCCAGCCATCGTTGACTGGTTGAGCGGTACCGAAGGCTACGAGAACAGCTTC
GTATACCAAGCTGTCTAACAACACGTTGAAAATGAAGAGGAGGGCAAGAGTTACGCTCTC
AGACTCCTTATCCACTATCTTGGAGATATTCACCAACCATTACACGCTACCAGCAGAGTT
GACCACCAATACCCCAAGGGTGATGCTGGCGGAAACTTCTTCCACGTTGCCCAAAAGGGA
GAGGTCAAGAACCTCCACTCACTCTGGGACTCAGTTGTCTACGAATTCACAGACACCCCA
TCCATGCCATACAACTCCAATGGTTGGAACAAACTCGGCAGCGCCATCCAAACCATGGCC
AGCAAATTCACTTTCCCCAACAACGAATACAACAGCGTTGACGTCAACCTATGGGTTAAT
GAGTCATTCGAAGTTGCCCAAAACGCCGTATATGCCAATATCAAGGAAAACCAAGCTGCC
TCTGATTCTTATGTCCAATAGAACCAAAAGGTTATTGAGAAGCAAATCATTATTGGAGGT
TTGAGACTCGCCACCGTCATTAAGCAAGTTTTCGGTAACAACACCAACCAAGCCGCCGCT
TTCCTTCAGTGA


>Contig21164.0.g44(protein)
MKYQILSTLLLXLLTSRATAFWQQGHLMVARVAYNHLQSEAPEALKAANDMLAVYSKSNP
SMTKLEGDYPFVECATFADEIKAKGGAFQSGWHFIDTPYLDQGGSISDYPQFKFDENHIG
KVIPAIVDWLSGTEGYENSFVYQAVQQHVENEEEGKSYALRLLIHYLGDIHQPLHATSRV
DHQYPKGDAGGNFFHVAQKGEVKNLHSLWDSVVYEFTDTPSMPYNSNGWNKLGSAIQTMA
SKFTFPNNEYNSVDVNLWVNESFEVAQNAVYANIKENQAASDSYVQQNQKVIEKQIIIGG
LRLATVIKQVFGNNTNQAAAFLQ