Identifiers and Description

Gene Model Identifier

Contig21043.0.1.g21

Standard Name

NAB2

Aliases

Contig21043_0_1_g21

Description

Topoisomerase DNA binding C4 zinc finger

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( pfam01396 ) Topoisomerase DNA binding C4 zinc finger

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_007707403.001003044337619e-17zinc finger protein
SGDYGL122C0.000030009396760408108NAB2 SGDID:S000003090, Chr VII
from 280523-278946, Geno...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig21043.0.1.g21(coding)
ATGAGCAATTCTGATGCAATAGTAGATTATATTGCCACAATTGCAGTAAAAGAAGATGTT
CAAAGATCAGAGCTTGTTGCCTAATTACAAGAACTATTTAATGAAGGTACTCAAAGCTTA
GTAGACTGGCTATTTACACACTTACAACCTAAATATGCCTCAAATGCTGGTCAAACTTTC
ATGGATGAATTCGCAGATGCAAATAATGATTTCAACGATGAGATCAAACAGATGGAGCAA
CAAGTCAAACTTTCATCAACAGTTGGAGCTAAAAGTGACTCTTTATAATCAAATAAGCCT
GATCAAAGAATCGGTGGAGTCGGTGCAAACATGCTTATGAAAGCTTGCCAGGATGCATCT
CAAGCAACTAAAAATCTAAGTGTGGATAAAAACACACAATAACAATAGCAAAGAAAGATC
ATCACTTTAGATAAGTCAAATAATGGAAGCAATAATCCTGAGAATACTGAATAAACTTCA
AGGATCATTAATACCAATGATGTCTTTGATAGGTTGAAAAAACGACCAATCGGTACAAGG
GATCAGTCTTATCTAGAGACAGACTTAGAGACATTAATTAGGAAAGAAGGTGTGAACAGG
AAGGGAGGTCATCACTAATAATAATAGCAAGAAAAAGTTGATATTACTTAGAGAATCAGG
AAACCTGAGAAATCTTACGGTGGGTTTTAGGGAAGCAGAAAATAGGAGGAAGTCAAGTTA
GATCCATCATCAAGCTCTGTGATTGATTTGAGTTCTTTTAGAAATAATGTCAGGTCAAAA
GCATAGCCTGATGCTCATGAAGATAAAGAAAAGAAACTCGTTAAATGCAGACATTACCCA
CATTGCAAACATACAGATGAAGAATGCCCATATCACCATCCTTAAGAGCAATGCGAATTT
TTCCCCAAATGCACATTTGGTGAAAAATGTCTTAACATCCACCCTGATATTCCTTGTAAG
TTTGGGATTTCCTGTTACAACCCAAAATGTCAATACACTCATCCAAAGGGTAGAATGGCT
TCAGGTGCTATGAATCCAGCTCAACTTTAGAAAACACTAAGTATGTTTATGATGGCTAGC
ATGGGAATGATGGGAAATAAACCTAAAAGCAAAAAGTTCTAAGCTGACTAAAACTTAGAG
AACCCAAATCCTGCACAAGACACTATATAAGAACAGTAGCAAGAAACCGCAATTCAAAAT
CCTAATTAATGA


>Contig21043.0.1.g21(protein)
MSNSDAIVDYIATIAVKEDVQRSELVAQLQELFNEGTQSLVDWLFTHLQPKYASNAGQTF
MDEFADANNDFNDEIKQMEQQVKLSSTVGAKSDSLQSNKPDQRIGGVGANMLMKACQDAS
QATKNLSVDKNTQQQQQRKIITLDKSNNGSNNPENTEQTSRIINTNDVFDRLKKRPIGTR
DQSYLETDLETLIRKEGVNRKGGHHQQQQQEKVDITQRIRKPEKSYGGFQGSRKQEEVKL
DPSSSSVIDLSSFRNNVRSKAQPDAHEDKEKKLVKCRHYPHCKHTDEECPYHHPQEQCEF
FPKCTFGEKCLNIHPDIPCKFGISCYNPKCQYTHPKGRMASGAMNPAQLQKTLSMFMMAS
MGMMGNKPKSKKFQADQNLENPNPAQDTIQEQQQETAIQNPNQ